{# protein-detail.css supplies the hero/card/binders-table/binder-intel/binder-mol-modal styling this page deliberately reuses verbatim (same markup, same tokens) -- human-protein-detail.css only adds the genuinely new human-specific classes. #}

Human curated protein

A0A075B6I6

Probable non-functional immunoglobulin lambda variable 1-50

Gene: IGLV1-50 Organism: Homo sapiens Reviewed UniProt
Length 118 aa
Mass 12,339 Da
Annotation score 3/5
Entry version 55
Ligand records 134

Overview

Probable non-functional open reading frame (ORF) of V region of the variable domain of immunoglobulin light chains (PubMed:24600447).

Most probably a non-functional protein that cannot participate in the synthesis of a productive immunoglobulin chain due to an unusual recombination signal (RS) sequence altering V-(D)-J recombination (PubMed:9619395)

Subunit structure

Immunoglobulins are composed of two identical heavy chains and two identical light chains; disulfide-linked

Polymorphism

There are several alleles. The sequence shown is that of IMGT allele IGLV1-50*01

Function

Molecular function, catalytic activity, and Gene Ontology annotations.

0 EC 5 GO

Probable non-functional open reading frame (ORF) of V region of the variable domain of immunoglobulin light chains (PubMed:24600447). Non-functional ORF generally cannot participate in the synthesis of a productive immunoglobulin chain due to altered V-(D)-J or switch recombination and/or splicing site (at mRNA level) and/or conserved amino acid change (protein level) (PubMed:9619395). Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins-secreting plasma cells. Secreted immunoglobulins mediate the effector phase of humoral immunity, which results in the elimination of bound antigens (PubMed:20176268, PubMed:22158414). The antigen binding site is formed by the variable domain of one heavy chain, together with that of its associated light chain. Thus, each immunoglobulin has two antigen binding sites with remarkable affinity for a particular antigen. The variable domains are assembled by a process called V-(D)-J rearrangement and can then be subjected to somatic hypermutations which, after exposure to antigen and selection, allow affinity maturation for a particular antigen (PubMed:17576170, PubMed:20176268)

Biological process

adaptive immune response immune response

Cellular component

extracellular region immunoglobulin complex plasma membrane

Sequence

118 amino acids

MAWSSLLLTLLAHCTGSWAQSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYVVHWYQQLPGTAPKLLIYGNSNRPSGVPDQFSGSKSGTSASLAITGLQSEDEADYYCKAWDNSLNA
Signal
1–19
Chain
20–118 Probable non-functional immunoglobulin lambda variable 1-50
Domain
20–118 Ig-like
Region
20–44 Framework-1
45–53 Complementarity-determining-1
54–70 Framework-2
71–73 Complementarity-determining-2
74–109 Framework-3
110–118 Complementarity-determining-3
Disulfide bond
41–109

Ligand evidence

Ligands grouped by evidence source, via the same LigQ_2 pipeline used across Target.

134 records
Chemistry signal

Structural and bioactivity evidence are both available for this target.

Direct evidence 0 same-protein records
Transferred evidence 84 records from similar proteins
Structural ligands 55 0 loaded crystals
Measured bioactivity 29 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
15P RCSB PDB P01709 1529.8 Da LogP 0.17 TPSA 334.1 2 viol. ✓ Clean COCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCO…
2M9 RCSB PDB P01660 472.5 Da LogP 2.33 TPSA 172.3 ✓ Ro5 ✓ Clean COc1cc(c2ccc3c(cc(c4c3c2c1cc4)S(=O)(=O)O)S(=O)(…
33O RCSB PDB A2NHM3 590.7 Da LogP -0.83 TPSA 151.2 2 viol. ✓ Clean C(COCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCO)O
88Q RCSB PDB Q5NV90 262.3 Da LogP -1.21 TPSA 99.4 ✓ Ro5 ✓ Clean C1C[C@@](CO[C@@H]1[C@@H]2CC[C@@](CO2)(CO)O)(CO)O
ACM RCSB PDB A2NHM3 59.1 Da LogP -0.51 TPSA 43.1 ✓ Ro5 ✓ Clean CC(=O)N
AN1 RCSB PDB Q65ZC0 264.3 Da LogP 4.32 TPSA 37.3 ✓ Ro5 ✓ Clean Cc1c2ccccc2c(c3c1cccc3)CCC(=O)O
ANF RCSB PDB P01724 194.2 Da LogP 3.70 TPSA 20.2 ✓ Ro5 ✓ Clean c1ccc2c(c1)cc3ccccc3c2O
ANO RCSB PDB P01631 288.4 Da LogP 4.17 TPSA 34.1 ✓ Ro5 ✓ Clean C[C@]12CCC(=O)C[C@H]1CC[C@@H]3[C@@H]2CC[C@]4([C…
ANQ RCSB PDB P01724 182.2 Da LogP 2.22 TPSA 34.1 ✓ Ro5 Alert c1cc2cccc3c2c(c1)C(=O)C3=O
AZI RCSB PDB P01631 42.0 Da LogP 0.87 TPSA 58.7 ✓ Ro5 Alert [N-]=[N+]=[N-]
AZN RCSB PDB P01724 320.3 Da LogP 1.12 TPSA 129.0 ✓ Ro5 Alert c1ccc2c(c1)C(=O)c3cc(c(c(c3C2=O)O)O)S(=O)(=O)O
B3P RCSB PDB Q8TCD0 282.3 Da LogP -4.01 TPSA 145.4 1 viol. ✓ Clean C(CNC(CO)(CO)CO)CNC(CO)(CO)CO
BEZ RCSB PDB Q58EU8 122.1 Da LogP 1.38 TPSA 37.3 ✓ Ro5 ✓ Clean c1ccc(cc1)C(=O)O
CAC RCSB PDB P01724 137.0 Da LogP -0.52 TPSA 40.1 ✓ Ro5 ✓ Clean C[As](=O)(C)[O-]
CPD RCSB PDB A2NHM3 743.5 Da LogP 4.81 TPSA 183.4 1 viol. ✓ Clean CCNC(=O)N(CCCN(C)C)[P@](=O)(Cc1ccc(cc1)NC(=O)C(…
DNS RCSB PDB P01631 379.5 Da LogP 1.77 TPSA 112.7 ✓ Ro5 ✓ Clean CN(C)c1cccc2c1cccc2S(=O)(=O)NCCCC[C@@H](C(=O)O)N
DP4 RCSB PDB Q58EU8 249.4 Da LogP 2.71 TPSA 23.1 ✓ Ro5 ✓ Clean C[N+]1(CCC(CC1)[Si](C)(C)c2ccccc2)[O-]
E3G RCSB PDB P01631 446.5 Da LogP 1.38 TPSA 133.5 ✓ Ro5 ✓ Clean C[C@]12CC[C@@H]3c4ccc(cc4CC[C@H]3[C@@H]1CCC2=O)…
EST RCSB PDB Q7TS98 272.4 Da LogP 3.61 TPSA 40.5 ✓ Ro5 ✓ Clean C[C@]12CC[C@@H]3c4ccc(cc4CC[C@H]3[C@@H]1CC[C@@H…
ETX RCSB PDB Q52L64 90.1 Da LogP 0.02 TPSA 29.5 ✓ Ro5 ✓ Clean CCOCCO
FLC RCSB PDB Q5NV67 189.1 Da LogP -5.25 TPSA 140.6 ✓ Ro5 ✓ Clean C(C(=O)[O-])C(CC(=O)[O-])(C(=O)[O-])O
FLU RCSB PDB Q65ZC0 332.3 Da LogP 3.97 TPSA 87.7 ✓ Ro5 ✓ Clean c1ccc(c(c1)C2=C3C=CC(=O)C=C3Oc4c2ccc(c4)O)C(=O)O
FUR RCSB PDB P01724 223.1 Da LogP 0.82 TPSA 103.8 ✓ Ro5 ✓ Clean c1cc(oc1C=NN2C=COC2=O)[N+](=O)[O-]
GAS RCSB PDB A2P1G9 384.4 Da LogP 3.79 TPSA 97.5 ✓ Ro5 ✓ Clean c1ccc(cc1)C(c2ccccc2)NC(=NCC(=O)O)Nc3ccc(cc3)C#N
GAS RCSB PDB G0YP42 384.4 Da LogP 3.79 TPSA 97.5 ✓ Ro5 ✓ Clean c1ccc(cc1)C(c2ccccc2)NC(=NCC(=O)O)Nc3ccc(cc3)C#N
HBC RCSB PDB Q52L64 291.4 Da LogP 3.78 TPSA 43.1 ✓ Ro5 ✓ Clean c1ccc(cc1)[C@@H]2[C@H]3CC[C@H](C3)[C@@]2(C(=O)c…
HOP RCSB PDB Q7Z3Y4 381.5 Da LogP 3.69 TPSA 86.6 ✓ Ro5 ✓ Clean c1ccc(cc1)[C@H]2CC[C@@H]([C@H](C2)O)c3ccc(cc3)C…
IUM RCSB PDB P06312 270.0 Da LogP -2.38 TPSA 46.1 ✓ Ro5 ✓ Clean [O-][U+4][O-]
LDA RCSB PDB P01636 229.4 Da LogP 4.48 TPSA 23.1 ✓ Ro5 ✓ Clean CCCCCCCCCCCC[N+](C)(C)[O-]
LMT RCSB PDB P01636 510.6 Da LogP -0.45 TPSA 178.5 3 viol. ✓ Clean CCCCCCCCCCCCO[C@H]1[C@@H]([C@H]([C@@H]([C@H](O1…
MBT RCSB PDB P01709 284.4 Da LogP 3.86 TPSA 19.4 ✓ Ro5 ✓ Clean CN(C)c1ccc2c(c1)[s+]c3cc(ccc3n2)N(C)C
MOI RCSB PDB P01724 285.3 Da LogP 1.20 TPSA 52.9 ✓ Ro5 ✓ Clean C[N@]1CC[C@]23c4c5ccc(c4O[C@H]2[C@H](C=C[C@H]3[…
MT1 RCSB PDB A2NHM3 455.5 Da LogP -0.31 TPSA 211.8 ✓ Ro5 ✓ Clean CN(Cc1cnc2c(n1)c(nc([nH+]2)N)N)c3ccc(cc3)C(=O)N…
NCH RCSB PDB P01724 305.2 Da LogP 1.80 TPSA 98.9 ✓ Ro5 ✓ Clean C[N+](C)(C)CCO[P@](=O)(O)Oc1ccc(cc1)[N+](=O)[O-]
NDG RCSB PDB Q52L64 221.2 Da LogP -3.08 TPSA 119.3 ✓ Ro5 ✓ Clean CC(=O)N[C@@H]1[C@H]([C@@H]([C@H](O[C@@H]1O)CO)O…
NES RCSB PDB A2P1G9 229.3 Da LogP -2.82 TPSA 127.1 ✓ Ro5 ✓ Clean C(CS(=O)(=O)O)NC(CO)(CO)CO
NIP RCSB PDB P01724 435.2 Da LogP 0.87 TPSA 132.6 ✓ Ro5 ✓ Clean c1c(cc(c(c1[N+](=O)[O-])O)I)CC(=O)NCCCCCC(=O)[O…
NPA RCSB PDB G0YP42 197.1 Da LogP 0.93 TPSA 100.7 ✓ Ro5 ✓ Clean c1cc(c(cc1CC(=O)O)[N+](=O)[O-])O
NPO RCSB PDB Q58EU8 139.1 Da LogP 1.30 TPSA 63.4 ✓ Ro5 ✓ Clean c1cc(ccc1[N+](=O)[O-])O
OX1 RCSB PDB Q65ZC0 296.3 Da LogP 3.33 TPSA 55.8 ✓ Ro5 ✓ Clean CC12c3ccccc3C(c4c1cccc4)(OO2)CCC(=O)O
PDE RCSB PDB Q58EU8 360.3 Da LogP 1.53 TPSA 156.1 ✓ Ro5 ✓ Clean C[C@@H](C(=O)O)NC(=O)CCC[P@@](=O)(O)Oc1ccc(cc1)…
PEO RCSB PDB P01636 34.0 Da LogP 0.02 TPSA 40.5 ✓ Ro5 ✓ Clean OO
PER RCSB PDB P01636 32.0 Da LogP -2.38 TPSA 46.1 ✓ Ro5 ✓ Clean [O-][O-]
PGG RCSB PDB Q58EU8 346.2 Da LogP 1.14 TPSA 156.1 ✓ Ro5 ✓ Clean c1cc(ccc1[N+](=O)[O-])O[P@@](=O)(CCCC(=O)NCC(=O…
PME RCSB PDB P01709 294.3 Da LogP -0.31 TPSA 118.7 ✓ Ro5 ✓ Clean COC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CC(=O)O)N
PNE RCSB PDB Q58EU8 360.3 Da LogP 1.53 TPSA 156.1 ✓ Ro5 ✓ Clean CC(C(=O)O)NC(=O)CCC[P@@](=O)(O)Oc1ccc(cc1)[N+](…
PNF RCSB PDB Q58EU8 402.3 Da LogP 2.70 TPSA 156.1 ✓ Ro5 ✓ Clean c1cc(ccc1[N+](=O)[O-])O[P@@](=O)(CCCC(=O)NCCCCC…
RBF RCSB PDB Q5FWF9 376.4 Da LogP -1.72 TPSA 161.6 ✓ Ro5 ✓ Clean Cc1cc2c(cc1C)N(C3=NC(=O)NC(=O)C3=N2)C[C@@H]([C@…
SAS RCSB PDB P01709 398.4 Da LogP 3.70 TPSA 141.3 ✓ Ro5 Alert c1ccnc(c1)NS(=O)(=O)c2ccc(cc2)/N=N/c3ccc(c(c3)C…
SC5 RCSB PDB A2P1G9 330.4 Da LogP 1.09 TPSA 102.6 1 viol. ✓ Clean C[C@H](c1ccccc1)NC(NCC(O)O)Nc2ccc(cc2)CN
STG RCSB PDB P01631 464.5 Da LogP 0.15 TPSA 156.9 1 viol. ✓ Clean C[C@]12CC[C@@H]3c4ccc(cc4CC[C@H]3[C@@H]1C[C@H](…
STR RCSB PDB P01631 314.5 Da LogP 4.72 TPSA 34.1 ✓ Ro5 ✓ Clean CC(=O)[C@H]1CC[C@@H]2[C@@]1(CC[C@H]3[C@H]2CCC4=…
TES RCSB PDB Q65ZC0 288.4 Da LogP 3.88 TPSA 37.3 ✓ Ro5 ✓ Clean C[C@]12CC[C@H]3[C@H]([C@@H]1CC[C@@H]2O)CCC4=CC(…
TMO RCSB PDB P01619 75.1 Da LogP 0.19 TPSA 23.1 ✓ Ro5 ✓ Clean C[N+](C)(C)[O-]
TPM RCSB PDB A2NHM3 204.3 Da LogP 0.02 TPSA 52.0 ✓ Ro5 Alert c1cc(ccc1CNC2=[NH+]CCCC2)N

Cross-references

External database identifiers grouped by category.

Structure

  • AlphaFoldDBA0A075B6I6
  • EMDBEMD-12570
  • EMDBEMD-44276
  • EMDBEMD-4452
  • EMDBEMD-9649
  • EMDBEMD-9650
  • EMDBEMD-9651
  • SMRA0A075B6I6

Family & domains

  • Gene3D2.60.40.10
  • InterProIPR007110
  • InterProIPR036179
  • InterProIPR013783
  • InterProIPR003599
  • InterProIPR013106
  • InterProIPR050150
  • PANTHERPTHR23267
  • PfamPF07686
  • SMARTSM00409
  • SMARTSM00406
  • SUPFAMSSF48726
  • PROSITEPS50835

Sequence

  • EMBLAC245060

Genome annotation

  • EnsemblENST00000390291.2
  • UCSCuc062cbn.1

Organism databases

  • GeneCardsIGLV1-50
  • HGNCHGNC:5881

Expression

  • BgeeENSG00000211645

Phylogenomics

  • GeneTreeENSGT00940000154293
  • HOGENOMCLU_077975_4_0_1
  • InParanoidA0A075B6I6
  • OMAEYYCATW
  • OrthoDB9838202at2759
  • PhylomeDBA0A075B6I6

Proteomic

  • MassIVEA0A075B6I6

Other

  • FunCoupA0A075B6I6
  • BioMutaIGLV1-50
  • AGRHGNC:5881
  • HPAENSG00000211645
  • VEuPathDBHostDB:ENSG00000211645
  • PAN-GOA0A075B6I6
  • SignaLinkA0A075B6I6
  • AgoraENSG00000211645
  • PROPR:A0A075B6I6
  • ProteomesUP000005640
  • RNActA0A075B6I6
  • GOGO:0005576
  • GOGO:0019814
  • GOGO:0005886
  • GOGO:0002250
  • GOGO:0006955
  • FunFam2.60.40.10:FF:000442