Protein target profile

VK055_0034

CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase

Genome: KpATCC43816 Gene: pgsA AIK78665.1 3D evidence: AlphaFold DB model + ColabFold model Metabolism 1 reaction UniProt A0A377ZDH9
Length 182
Pocket druggability 0.599
Metabolic reactions 1
Chokepoint No
Direct ligand evidence 0 9 total records
Functional annotation 1 EC 6 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
41.333 Lower values reduce human off-target concern.
Human E-value
1.83e-08
Gut microbiome similarity
3.7% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
90.11 Higher values support similarity to known essential genes.
DEG E-value
2.5800000000000003e-116 Smaller values mean stronger essential-gene similarity.

Localization

Localization
CytoplasmicMembrane

Structure confidence

ColabFold pLDDT
89.99 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

The selected pocket score is the FPocket value used for ranking after applying the curated structure priority. It estimates small-molecule pocket quality; it is not experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

FPocket 0.599
Structure A0A377ZDH9
Pocket Pocket 1
P2Rank 0.582
Structure A0A377ZDH9
Pocket Pocket 1
ColabFold model
FPocket 0.729 · Pocket 9
P2Rank 0.457 · Pocket 1
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 175 / 4744 genomes with a hit
Prevalence 3.7%

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

Explore metabolic network

Metabolic context: more central than 99.5% of genes in this genome.

Relative network centrality 99.5% more central than 99.5% of genes in this genome
Chokepoint Not a chokepoint
Catalyzed reaction

1 reaction mapped to this gene in the metabolic model. Open the full network to see each one, with substrates/products and the reaction-reaction map.

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MQFNIPTLLTLFRVILIPFFVLAFYLPFSWAPFACALIFFVAAVTDWFDGFLARRWNQSTRFGAFLDPVADKVMVAIAMVLVAEHYHTWWVTLPAATMIAREIIISALREWMAELGKRSSVAVSWIGKVKTTAQMTALVWMLWRPYPWVEWAGIALFLVAAVLTLWSMLQYLNAARGDLLDQ

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 6 GO

Enzyme Commission (EC)

1

Gene Ontology (GO)

6
  • GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
  • GO:0008654 The chemical reactions and pathways resulting in the formation of a phospholipid, a lipid containing phosphoric acid as a mono- or diester.
  • GO:0008444 Catalysis of the reaction: sn-glycerol 3-phosphate + CDP-diacylglycerol = 3-(3-sn-phosphatidyl)-sn-glycerol 1-phosphate + CMP + H+.
  • GO:0016780 Catalysis of the transfer of a substituted phosphate group, other than diphosphate or nucleotidyl residues, from one compound (donor) to a another (acceptor).
  • GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
  • GO:0006655 The chemical reactions and pathways resulting in the formation of phosphatidylglycerols, any of a class of phospholipids in which the phosphatidyl group is esterified to the hydroxyl group of glycerol.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

31 records
Show feature table
Start End DB Term Name
3 157 PANTHER PTHR14269 CDP-DIACYLGLYCEROL--GLYCEROL-3-PHOSPHATE 3-PHOSPHATIDYLTRANSFERASE-RELATED
7 26 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
149 169 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
84 88 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
64 83 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
7 25 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
170 182 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
53 63 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
109 119 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
26 30 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
120 143 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
49 71 ProSitePatterns PS00379 CDP-alcohol phosphatidyltransferases signature.
49 71 InterPro IPR000462 CDP-alcohol phosphatidyltransferase
3 165 Pfam PF01066 CDP-alcohol phosphatidyltransferase
3 165 InterPro IPR000462 CDP-alcohol phosphatidyltransferase
3 179 FunFam G3DSA:1.20.120.1760:FF:000001 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase
1 177 PIRSF PIRSF000847 Phos_ph_gly_syn
1 177 InterPro IPR004570 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase
144 148 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
121 143 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
1 182 Hamap MF_01437 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase [pgsA].
1 182 InterPro IPR023762 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase, bacterial
3 180 NCBIfam TIGR00560 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase
3 180 InterPro IPR004570 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase
31 52 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
89 108 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
30 52 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
147 169 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
1 6 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
3 178 Gene3D G3DSA:1.20.120.1760 -
3 178 InterPro IPR043130 CDP-alcohol phosphatidyltransferase, transmembrane domain

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · FPocket

Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Site 1 FPocket #1
0.599
Likely same site as P2Rank 1 6.4 Å 17 shared residues 71% of smaller site
Unusual size
Show in viewer
Surrounding area

Binding pockets · P2Rank

Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Site 1 P2Rank #1
0.582
Likely same site as FPocket 1 6.4 Å 17 shared residues 71% of smaller site
Show in viewer
Surrounding area
Site 2 P2Rank #2
0.016
Show in viewer
Surrounding area
Site 3 P2Rank #3
0.006
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A377ZDH9
AlphaFold DB full sequence Viewing
ColabFold VK055_0034
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

9 records
Chemistry signal

Bioactivity evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 3 records from similar proteins
Structural ligands 0 0 loaded crystals
Measured bioactivity 3 direct and transferred ChEMBL records
Proposed compounds 6 similarity-based ZINC candidates
Best available ligand signal
DXH ChEMBL via homolog pchembl 9.00 (~1.0 nM) 503.5 Da · LogP 5.75 · TPSA 97.6 Open detail ChEMBL
DWT ChEMBL via homolog · pchembl 7.24 (~57.5 nM) Detail ChEMBL
FCN ChEMBL via homolog Detail ChEMBL
ZINC220133900 ZINC proposed compound · Tanimoto 0.538 Detail ZINC
ZINC20148987 ZINC proposed compound · Tanimoto 0.532 Detail ZINC

Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).

Show only:
Ligand UniProt (homolog) pchembl MW · LogP · TPSA Lipinski PAINS SMILES
DXH ChEMBL O14735 9.00 ~1.0 nM 503.5 Da LogP 5.75 TPSA 97.6 2 viol. ✓ Clean Cc1ccc(cc1Nc2c3cnn(c3nc(n2)c4cccnc4)C)C(=O)Nc5c…
DWT ChEMBL O14735 7.24 ~57.5 nM 503.5 Da LogP 5.75 TPSA 97.6 2 viol. ✓ Clean Cc1ccc(cc1Nc2c3cn(nc3nc(n2)c4cccnc4)C)C(=O)Nc5c…
FCN ChEMBL P0ABF8 138.1 Da LogP -0.09 TPSA 70.1 ✓ Ro5 ✓ Clean C[C@H]1[C@H](O1)P(=O)(O)O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.