KpATCC43816 Protein target profile

tRNA (cmo5U34)-methyltransferase

Accession: VK055_0063

Gene: cmoA AIK78691.1 3D evidence: AlphaFold DB model + ColabFold model Metabolism 1 reaction UniProt A0A0H3GS19
Length 247
Pocket druggability (P2Rank · AlphaFold DB model) 0.964
Metabolic reactions 1
Chokepoint Yes
Functional annotation 1 EC 5 GO
Target summary

Strong target candidate with converging metabolic, structural and chemical evidence.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
3.2% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
31.855 Higher values support similarity to known essential genes.

Structure confidence

ColabFold pLDDT
92.34 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.964
Structure A0A0H3GS19
Pocket Pocket 1
Druggability (FPocket) 0.889
Structure A0A0H3GS19
Pocket Pocket 3
ColabFold model
P2Rank 0.97 · Pocket 1
FPocket 0.851 · Pocket 1
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 151 / 4744 genomes with a hit
Prevalence 3.2%

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

Explore metabolic network

Attractive metabolic target: catalyzes a producing & consuming chokepoint reaction, no isoenzyme backup detected, more central than 88.2% of genes in this genome, no human homolog detected.

Relative network centrality 88.2% more central than 88.2% of genes in this genome
Chokepoint Chokepoint gene
Pathways

No specific KEGG pathway assigned - this reaction either has no KEGG mapping, or only matches a generic overview map with no route-level information.

Catalyzed reaction

1 reaction mapped to this gene in the metabolic model. Open the full network to see each one, with substrates/products and the reaction-reaction map.

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MSHRDTLFSAPIASLGDWTFDERVAEVFPDMIQRSVPGYSNIISMIGMLAERFVQPNTQVYDLGCSLGAATLSVRRNISHPGCRIIAIDNSPAMVERCRRHIDAYKAPTPVEVIEGDIRDVTIENASLVILNFTIQFLEPGDRQAILNKVYQGLNRGGALVLSEKFSFEDAHVGELLFNMHHDFKRANGYSELEISQKRSMLENVMLTDSVETHKARLRQAGFEHAELWFQCFNFGSLVAVKAGEQA

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 5 GO

Subcellular localization

Localization
Cytoplasmic

Enzyme Commission (EC)

1

Gene Ontology (GO)

5
  • GO:0002098 The process in which a uridine at position 34 of a tRNA is post-transcriptionally modified. The wobble nucleoside of the tRNA sequence (position 34) corresponds to the first position of the anticodon.
  • GO:0016743 Catalysis of the transfer of a carboxyl- or carbamoyl group from one compound (donor) to another (acceptor).
  • GO:0008168 Catalysis of the transfer of a methyl group to an acceptor molecule.
  • GO:1904047 Binding to S-adenosyl-L-methionine.
  • GO:0032259 The process in which a methyl group is covalently attached to a molecule.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

14 records
Show feature table
Start End DB Term Name
18 247 Gene3D G3DSA:3.40.50.150 Vaccinia Virus protein VP39
18 247 InterPro IPR029063 S-adenosyl-L-methionine-dependent methyltransferase superfamily
4 242 NCBIfam TIGR00740 carboxy-S-adenosyl-L-methionine synthase CmoA
4 242 InterPro IPR005271 Carboxy-S-adenosyl-L-methionine synthase
60 163 CDD cd02440 AdoMet_MTases
3 242 Hamap MF_01589 Carboxy-S-adenosyl-L-methionine synthase [cmoA].
3 242 InterPro IPR005271 Carboxy-S-adenosyl-L-methionine synthase
1 243 PIRSF PIRSF006325 Mtase_YecO
1 243 InterPro IPR005271 Carboxy-S-adenosyl-L-methionine synthase
20 242 SUPERFAMILY SSF53335 S-adenosyl-L-methionine-dependent methyltransferases
20 242 InterPro IPR029063 S-adenosyl-L-methionine-dependent methyltransferase superfamily
60 158 Pfam PF13649 Methyltransferase domain
60 158 InterPro IPR041698 Methyltransferase domain 25
5 232 PANTHER PTHR43861 TRANS-ACONITATE 2-METHYLTRANSFERASE-RELATED

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.964
Likely same site as FPocket 3 1.5 Å 37 shared residues 97% of smaller site
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.135
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.019
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #3
0.889 Unusual size
Likely same site as P2Rank 1 1.5 Å 37 shared residues 97% of smaller site
Show in viewer
Surrounding area
Residue sets
UniProt: Binding site:117-118
UniProt: Binding site:132-132
UniProt: Binding site:199-199
UniProt: Binding site:39-39
UniProt: Binding site:64-66
UniProt: Binding site:89-90
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GS19
AlphaFold DB full sequence Viewing
ColabFold VK055_0063
ColabFold full sequence Loaded

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.