Promising target candidate with multiple supporting evidence streams.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- Hit
- Human identity (%)
- 29.752 Lower values reduce human off-target concern.
- Human E-value
- 2.7e-07
- Gut microbiome similarity
- 89.9% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- Y
- DEG identity (%)
- 95.238 Higher values support similarity to known essential genes.
- DEG E-value
- 0.0 Smaller values mean stronger essential-gene similarity.
Localization
- Localization
- Cytoplasmic
Structure confidence
- ColabFold pLDDT
- 92.63 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelThe selected pocket score is the FPocket value used for ranking after applying the curated structure priority. It estimates small-molecule pocket quality; it is not experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.
Sequence
Chemistry
Sequence
Primary amino-acid sequence viewer.
MIEADRLVSADSSGFEEAADRAIRPKLLAEYVGQPQVRSQMEIFIQAAKLRGDALDHLLIFGPPGLGKTTLANIVANEMGVNLRTTSGPVLEKAGDLAAMLTNLEPHDVLFIDEIHRLSPVVEEVLYPAMEDYQLDIMIGEGPAARSIKIDLPPFTLIGATTRAGSLTSPLRDRFGIVQRLEFYQIPDLQHIVSRSARHMGLEMSDEGALEVARRSRGTPRIANRLLRRVRDFAEVRHDGTISADIAAQALDMLNVDAEGFDYMDRKLLLAVIDKFFGGPVGLDNLAAAIGEERETIEDVLEPYLIQQGFLQRTPRGRMATVRAWNHFGITPPEMP
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Enzyme Commission (EC)
1Gene Ontology (GO)
9- GO:0005524 Binding to ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
- GO:0006310 Any process in which a new genotype is formed by reassortment of genes resulting in gene combinations different from those that were present in the parents. In eukaryotes genetic recombination can occur by chromosome assortment, intrachromosomal recombination, or nonreciprocal interchromosomal recombination. Interchromosomal recombination occurs by crossing over. In bacteria it may occur by genetic transformation, conjugation, transduction, or F-duction.
- GO:0006281 The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
- GO:0016887 Catalysis of the reaction: ATP + H2O = ADP + H+ phosphate. ATP hydrolysis is used in some reactions as an energy source, for example to catalyze a reaction or drive transport against a concentration gradient.
- GO:0003677 Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
- GO:0009378 Unwinding a DNA helix of DNA containing four-way junctions, including Holliday junctions, driven by ATP hydrolysis.
- GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
- GO:0048476 An endodeoxyribonuclease complex that resolves the 4-way DNA intermediates of a Holliday junction into two separate duplex DNA molecules. Can be branch-migration associated.
- GO:0000400 Binding to a DNA segment containing four-way junctions, also known as Holliday junctions, a structure where two DNA double strands are held together by reciprocal exchange of two of the four strands, one strand each from the two original helices.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 186 | 258 | Gene3D | G3DSA:1.10.8.60 | - |
| 2 | 334 | PANTHER | PTHR42848 | - |
| 2 | 334 | InterPro | IPR004605 | Holliday junction branch migration complex subunit RuvB |
| 260 | 333 | SUPERFAMILY | SSF46785 | Winged helix DNA-binding domain |
| 260 | 333 | InterPro | IPR036390 | Winged helix DNA-binding domain superfamily |
| 54 | 181 | SMART | SM00382 | AAA_5 |
| 54 | 181 | InterPro | IPR003593 | AAA+ ATPase domain |
| 27 | 329 | NCBIfam | TIGR00635 | Holliday junction DNA helicase RuvB |
| 27 | 329 | InterPro | IPR004605 | Holliday junction branch migration complex subunit RuvB |
| 42 | 178 | CDD | cd00009 | AAA |
| 260 | 336 | Gene3D | G3DSA:1.10.10.10 | - |
| 260 | 336 | InterPro | IPR036388 | Winged helix-like DNA-binding domain superfamily |
| 184 | 257 | Pfam | PF17864 | RuvB AAA lid domain |
| 184 | 257 | InterPro | IPR041445 | RuvB, AAA lid domain |
| 186 | 258 | FunFam | G3DSA:1.10.8.60:FF:000023 | Holliday junction ATP-dependent DNA helicase RuvB |
| 1 | 336 | Hamap | MF_00016 | Holliday junction branch migration complex subunit RuvB [ruvB]. |
| 1 | 336 | InterPro | IPR004605 | Holliday junction branch migration complex subunit RuvB |
| 260 | 336 | FunFam | G3DSA:1.10.10.10:FF:000086 | Holliday junction ATP-dependent DNA helicase RuvB |
| 22 | 183 | FunFam | G3DSA:3.40.50.300:FF:000073 | Holliday junction ATP-dependent DNA helicase RuvB |
| 259 | 328 | Pfam | PF05491 | RuvB C-terminal winged helix domain |
| 259 | 328 | InterPro | IPR008823 | RuvB C-terminal winged helix domain |
| 22 | 183 | Gene3D | G3DSA:3.40.50.300 | - |
| 22 | 183 | InterPro | IPR027417 | P-loop containing nucleoside triphosphate hydrolase |
| 23 | 181 | Pfam | PF05496 | Holliday junction DNA helicase RuvB P-loop domain |
| 23 | 181 | InterPro | IPR008824 | RuvB-like P-loop domain |
| 23 | 255 | SUPERFAMILY | SSF52540 | P-loop containing nucleoside triphosphate hydrolases |
| 23 | 255 | InterPro | IPR027417 | P-loop containing nucleoside triphosphate hydrolase |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · FPocket
Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Residue sets
Binding pockets · FPocket
Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Residue sets
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3H053
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
VK055_0072
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural and bioactivity evidence are both available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| ADE RCSB PDB | Q5SL87 | 135.1 Da LogP -0.06 TPSA 80.5 | ✓ Ro5 | ✓ Clean |
c1[nH]c2c(n1)c(ncn2)N
|
|
| AF3 RCSB PDB | Q01853 | 84.0 Da LogP 0.88 TPSA 0.0 | ✓ Ro5 | ✓ Clean |
F[Al](F)F
|
|
| AGS RCSB PDB | G0S6Y2 | 523.2 Da LogP -1.51 TPSA 262.1 | 3 viol. | ✓ Clean |
c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
|
|
| ANP RCSB PDB | P55072 | 506.2 Da LogP -2.06 TPSA 281.9 | 3 viol. | ✓ Clean |
c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
|
|
| AWD RCSB PDB | P55072 | 237.3 Da LogP 1.60 TPSA 35.6 | ✓ Ro5 | ✓ Clean |
CN1CCN(CC1)C(=O)Nc2ccc(cc2)F
|
|
| EJQ RCSB PDB | P55072 | 222.3 Da LogP 1.86 TPSA 32.3 | ✓ Ro5 | ✓ Clean |
c1cc(ccc1NC(=O)CN2CCCC2)F
|
|
| EJW RCSB PDB | P55072 | 175.2 Da LogP 1.08 TPSA 53.7 | ✓ Ro5 | ✓ Clean |
c1ccc(cc1)c2cc(on2)C[NH3+]
|
|
| ELN RCSB PDB | P55072 | 194.6 Da LogP 2.19 TPSA 52.9 | ✓ Ro5 | ✓ Clean |
c1cc(ccc1NC(=O)CC#N)Cl
|
|
| ELQ RCSB PDB | P55072 | 240.3 Da LogP 1.35 TPSA 23.6 | ✓ Ro5 | ✓ Clean |
CN1CCN(CC1)C(=O)c2ccc(c(c2)F)F
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
| Ligand | UniProt (homolog) | pchembl | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| CHEMBL3747448 ChEMBL | P55072 | 8.22 ~6.0 nM | 411.5 Da LogP 4.32 TPSA 85.8 | ✓ Ro5 | ✓ Clean |
Cc1cc2c(C(N)=O)cccc2n1-c1nc2c(c(NCc3ccccc3)n1)C…
|
| JDP ChEMBL | P55072 | 7.96 ~11.0 nM | 413.5 Da LogP 3.51 TPSA 95.1 | ✓ Ro5 | ✓ Clean |
Cc1cc2c(cccc2n1c3nc4c(c(n3)NCc5ccccc5)COCC4)C(=…
|
| CHEMBL3746179 ChEMBL | P55072 | 7.82 ~15.1 nM | 437.5 Da LogP 3.17 TPSA 109.2 | ✓ Ro5 | ✓ Clean |
Cc1cc2c(-c3nnn[nH]3)cccc2n1-c1nc2c(c(NCc3ccccc3…
|
| CHEMBL4280801 ChEMBL | P55072 | 7.82 ~15.1 nM | 475.7 Da LogP 4.70 TPSA 37.5 | ✓ Ro5 | ✓ Clean |
CN1CCN(C2(CNC3CCN(c4cccc(-c5cc6cc(F)ccc6[nH]5)c…
|
| CHEMBL6064283 ChEMBL | P55072 | 7.82 ~15.1 nM | 510.7 Da LogP 5.21 TPSA 61.3 | 2 viol. | ✓ Clean |
CC(C)N1CCN(C2(CNC3CCN(c4cccc(-c5cc6cc(C#N)ccc6[…
|
| CHEMBL4555451 ChEMBL | P55072 | 7.73 ~18.6 nM | 451.5 Da LogP 3.78 TPSA 81.1 | ✓ Ro5 | ✓ Clean |
C#CCNC(=O)c1cccc2c1cc(C)n2-c1nc2c(c(NCc3ccccc3)…
|
| OJA ChEMBL | P55072 | 7.70 ~20.0 nM | 463.6 Da LogP 4.56 TPSA 37.5 | ✓ Ro5 | ✓ Clean |
CC(C)N1CCN(CC1)CCNC2CCN(CC2)c3cccc(c3)c4cc5cc(c…
|
| CHEMBL4553677 ChEMBL | P55072 | 7.68 ~20.9 nM | 439.6 Da LogP 5.57 TPSA 71.8 | 1 viol. | ✓ Clean |
CCC(=O)Nc1cccc2c1cc(C)n2-c1nc2c(c(NCc3ccccc3)n1…
|
| CHEMBL3747049 ChEMBL | P55072 | 7.64 ~22.9 nM | 413.5 Da LogP 3.51 TPSA 95.1 | ✓ Ro5 | ✓ Clean |
Cc1cc2c(C(N)=O)cccc2n1-c1nc2c(c(NCc3ccccc3)n1)C…
|
| CHEMBL4535337 ChEMBL | P55072 | 7.62 ~24.0 nM | 464.6 Da LogP 4.86 TPSA 95.6 | ✓ Ro5 | ✓ Clean |
Cc1cc2c(C(=O)NCCC#N)cccc2n1-c1nc2c(c(NCc3ccccc3…
|
| CHEMBL4441270 ChEMBL | P55072 | 7.61 ~24.5 nM | 463.6 Da LogP 4.97 TPSA 71.8 | ✓ Ro5 | ✓ Clean |
C#CCCNC(=O)c1cccc2c1cc(C)n2-c1nc2c(c(NCc3ccccc3…
|
| CHEMBL5937029 ChEMBL | P55072 | 7.60 ~25.1 nM | 477.7 Da LogP 4.87 TPSA 37.5 | ✓ Ro5 | ✓ Clean |
Cc1ccc(N2CCC(NCCN3CCN(C(C)C)CC3)CC2)cc1-c1cc2cc…
|
| CHEMBL4445673 ChEMBL | P55072 | 7.58 ~26.3 nM | 470.7 Da LogP 4.29 TPSA 61.3 | ✓ Ro5 | ✓ Clean |
CC(C)N1CCN(CCNC2CCN(c3cccc(-c4cc5cc(C#N)ccc5[nH…
|
| CHEMBL4453010 ChEMBL | P55072 | 7.58 ~26.3 nM | 439.5 Da LogP 4.54 TPSA 81.1 | ✓ Ro5 | ✓ Clean |
C=CC(=O)Nc1cccc2c1cc(C)n2-c1nc2c(c(NCc3ccccc3)n…
|
| CHEMBL5189708 ChEMBL | P55072 | 7.58 ~26.3 nM | 439.5 Da LogP 4.66 TPSA 92.1 | ✓ Ro5 | ✓ Clean |
C=CC(=O)Nc1cccc2c1cc(C)n2-c1nc2c(c(NCc3cccc(O)c…
|
| CHEMBL5966795 ChEMBL | P55072 | 7.58 ~26.3 nM | 482.7 Da LogP 4.44 TPSA 61.3 | ✓ Ro5 | ✓ Clean |
CN1CCN(C2(CNC3CCN(c4cccc(-c5cc6cc(C#N)ccc6[nH]5…
|
| CHEMBL4551165 ChEMBL | P55072 | 7.57 ~26.9 nM | 477.6 Da LogP 5.96 TPSA 71.8 | 1 viol. | ✓ Clean |
CCCC#CC(=O)Nc1cccc2c1cc(C)n2-c1nc2c(c(NCc3ccccc…
|
| CHEMBL4543206 ChEMBL | P55072 | 7.55 ~28.2 nM | 450.5 Da LogP 4.47 TPSA 95.6 | ✓ Ro5 | ✓ Clean |
Cc1cc2c(C(=O)NCC#N)cccc2n1-c1nc2c(c(NCc3ccccc3)…
|
| CHEMBL4463657 ChEMBL | P55072 | 7.51 ~30.9 nM | 449.6 Da LogP 4.58 TPSA 71.8 | ✓ Ro5 | ✓ Clean |
C#CCNC(=O)c1cccc2c1cc(C)n2-c1nc2c(c(NCc3ccccc3)…
|
| CHEMBL5192118 ChEMBL | P55072 | 7.51 ~30.9 nM | 457.5 Da LogP 4.22 TPSA 101.3 | ✓ Ro5 | ✓ Clean |
CCONC(=O)c1cccc2c1cc(C)n2-c1nc2c(c(NCc3cccc(O)c…
|
| CHEMBL4580172 ChEMBL | P55072 | 7.50 ~31.6 nM | 461.6 Da LogP 5.35 TPSA 71.8 | 1 viol. | ✓ Clean |
C=CC#CC(=O)Nc1cccc2c1cc(C)n2-c1nc2c(c(NCc3ccccc…
|
| CHEMBL4846448 ChEMBL | P55072 | 7.50 ~31.6 nM | 469.3 Da LogP 1.99 TPSA 121.5 | ✓ Ro5 | ✓ Clean |
CC#CC(=O)Nc1cccc2c1cc(C)n2-c1ncc(OC)c(NCc2cccc(…
|
| CHEMBL4460205 ChEMBL | P55072 | 7.49 ~32.4 nM | 451.5 Da LogP 4.38 TPSA 81.1 | ✓ Ro5 | ✓ Clean |
CC#CC(=O)Nc1cccc2c1cc(C)n2-c1nc2c(c(NCc3ccccc3)…
|
| CHEMBL4438398 ChEMBL | P55072 | 7.48 ~33.1 nM | 437.5 Da LogP 3.99 TPSA 81.1 | ✓ Ro5 | ✓ Clean |
C#CC(=O)Nc1cccc2c1cc(C)n2-c1nc2c(c(NCc3ccccc3)n…
|
| CHEMBL4459139 ChEMBL | P55072 | 7.48 ~33.1 nM | 449.6 Da LogP 5.18 TPSA 71.8 | 1 viol. | ✓ Clean |
CC#CC(=O)Nc1cccc2c1cc(C)n2-c1nc2c(c(NCc3ccccc3)…
|
| CHEMBL4451017 ChEMBL | P55072 | 7.46 ~34.7 nM | 489.6 Da LogP 4.32 TPSA 98.1 | ✓ Ro5 | ✓ Clean |
Cc1cc2c(NS(=O)(=O)C3CC3)cccc2n1-c1nc2c(c(NCc3cc…
|
| CHEMBL5175854 ChEMBL | P55072 | 7.46 ~34.7 nM | 428.5 Da LogP 3.84 TPSA 119.1 | ✓ Ro5 | ✓ Clean |
Cc1cc2c(C(=N)NO)cccc2n1-c1nc2c(c(NCc3cccc(O)c3)…
|
| CHEMBL3787674 ChEMBL | P55072 | 7.44 ~36.3 nM | 490.7 Da LogP 4.33 TPSA 80.7 | ✓ Ro5 | ✓ Clean |
CC(C)N1CCN(CCNC2CCN(c3cccc(-c4cc5cc([N+](=O)[O-…
|
| CHEMBL4461505 ChEMBL | P55072 | 7.44 ~36.3 nM | 463.6 Da LogP 3.79 TPSA 98.1 | ✓ Ro5 | ✓ Clean |
Cc1cc2c(NS(C)(=O)=O)cccc2n1-c1nc2c(c(NCc3ccccc3…
|
| CHEMBL4463689 ChEMBL | P55072 | 7.43 ~37.2 nM | 463.6 Da LogP 4.97 TPSA 71.8 | ✓ Ro5 | ✓ Clean |
CC#CCNC(=O)c1cccc2c1cc(C)n2-c1nc2c(c(NCc3ccccc3…
|
| CHEMBL4558932 ChEMBL | P55072 | 7.42 ~38.0 nM | 435.5 Da LogP 4.79 TPSA 71.8 | ✓ Ro5 | ✓ Clean |
C#CC(=O)Nc1cccc2c1cc(C)n2-c1nc2c(c(NCc3ccccc3)n…
|
| CHEMBL3747647 ChEMBL | P55072 | 7.40 ~39.8 nM | 412.5 Da LogP 3.09 TPSA 97.9 | ✓ Ro5 | ✓ Clean |
Cc1cc2c(C(N)=O)cccc2n1-c1nc2c(c(NCc3ccccc3)n1)C…
|
| CHEMBL4277404 ChEMBL | P55072 | 7.39 ~40.7 nM | 505.7 Da LogP 4.33 TPSA 46.8 | 1 viol. | ✓ Clean |
CC(C)N1CCN(C2(CNC3CCN(c4cccc(-c5cc6cc(F)ccc6[nH…
|
| CHEMBL4446356 ChEMBL | P55072 | 7.39 ~40.7 nM | 453.6 Da LogP 5.36 TPSA 71.8 | 1 viol. | ✓ Clean |
CCCNC(=O)c1cccc2c1cc(C)n2-c1nc2c(c(NCc3ccccc3)n…
|
| CHEMBL3696924 ChEMBL | P55072 | 7.37 ~42.7 nM | 384.5 Da LogP 4.92 TPSA 52.0 | ✓ Ro5 | ✓ Clean |
COc1cc2ccccc2n1-c1nc2c(c(NCc3ccccc3)n1)CCCC2
|
| CHEMBL4456523 ChEMBL | P55072 | 7.37 ~42.7 nM | 463.6 Da LogP 5.57 TPSA 71.8 | 1 viol. | ✓ Clean |
CCC#CC(=O)Nc1cccc2c1cc(C)n2-c1nc2c(c(NCc3ccccc3…
|
| CHEMBL4535642 ChEMBL | P55072 | 7.37 ~42.7 nM | 465.6 Da LogP 4.17 TPSA 81.1 | ✓ Ro5 | ✓ Clean |
CC#CCNC(=O)c1cccc2c1cc(C)n2-c1nc2c(c(NCc3ccccc3…
|
| CHEMBL5184848 ChEMBL | P55072 | 7.36 ~43.7 nM | 412.5 Da LogP 3.80 TPSA 97.9 | ✓ Ro5 | ✓ Clean |
Cc1cc2c(C(N)=O)cccc2n1-c1nc2c(c(NCc3ccccc3)n1)C…
|
| CHEMBL4862740 ChEMBL | P55072 | 7.34 ~45.7 nM | 505.4 Da LogP 2.27 TPSA 129.4 | 1 viol. | ✓ Clean |
Cc1cc2c(NS(C)(=O)=O)cccc2n1-c1nc2c(c(NCc3cccc(B…
|
| CHEMBL3696915 ChEMBL | P55072 | 7.33 ~46.8 nM | 368.5 Da LogP 5.22 TPSA 42.7 | 1 viol. | ✓ Clean |
Cc1cc2ccccc2n1-c1nc2c(c(NCc3ccccc3)n1)CCCC2
|
| CHEMBL6010286 ChEMBL | P55072 | 7.33 ~46.8 nM | 441.6 Da LogP 5.14 TPSA 58.1 | 1 viol. | ✓ Clean |
CC(C)N1CCC(NC2CCN(c3cccc(-c4cc5cc(C#N)ccc5[nH]4…
|
| CHEMBL5199985 ChEMBL | P55072 | 7.32 ~47.9 nM | 443.5 Da LogP 3.83 TPSA 101.3 | ✓ Ro5 | ✓ Clean |
CONC(=O)c1cccc2c1cc(C)n2-c1nc2c(c(NCc3cccc(O)c3…
|
| CHEMBL4288865 ChEMBL | P55072 | 7.31 ~49.0 nM | 434.6 Da LogP 5.41 TPSA 34.3 | 1 viol. | ✓ Clean |
CC(C)N1CCC(NC2CCN(c3cccc(-c4cc5cc(F)ccc5[nH]4)c…
|
| CHEMBL5184774 ChEMBL | P55072 | 7.31 ~49.0 nM | 479.5 Da LogP 5.38 TPSA 105.2 | 1 viol. | ✓ Clean |
Cc1cc2c(NC(=O)c3ccco3)cccc2n1-c1nc2c(c(NCc3cccc…
|
| CHEMBL5180155 ChEMBL | P55072 | 7.28 ~52.5 nM | 413.5 Da LogP 3.63 TPSA 106.1 | ✓ Ro5 | ✓ Clean |
Cc1cc2c(C(N)=O)cccc2n1-c1nc2c(c(NCc3cccc(O)c3)n…
|
| CHEMBL5205850 ChEMBL | P55072 | 7.27 ~53.7 nM | 471.3 Da LogP 1.80 TPSA 121.5 | ✓ Ro5 | ✓ Clean |
CONC(=O)c1cccc2c1cc(C)n2-c1nc2c(c(NCc3cccc(B(O)…
|
| CHEMBL4871978 ChEMBL | P55072 | 7.26 ~55.0 nM | 491.4 Da LogP 1.88 TPSA 129.4 | ✓ Ro5 | ✓ Clean |
Cc1cc2c(NS(C)(=O)=O)cccc2n1-c1nc2c(c(NCc3cccc(B…
|
| CHEMBL4858461 ChEMBL | P55072 | 7.24 ~57.5 nM | 507.4 Da LogP 3.35 TPSA 125.4 | 1 viol. | ✓ Clean |
Cc1cc2c(NC(=O)c3ccco3)cccc2n1-c1nc2c(c(NCc3cccc…
|
| CHEMBL4854511 ChEMBL | P55072 | 7.23 ~58.9 nM | 479.3 Da LogP 2.47 TPSA 112.3 | ✓ Ro5 | ✓ Clean |
CC#CC(=O)Nc1cccc2c1cc(C)n2-c1nc2c(c(NCc3cccc(B(…
|
| CHEMBL3696925 ChEMBL | P55072 | 7.17 ~67.6 nM | 384.5 Da LogP 4.40 TPSA 63.0 | ✓ Ro5 | ✓ Clean |
OCc1cc2ccccc2n1-c1nc2c(c(NCc3ccccc3)n1)CCCC2
|
| CHEMBL3745888 ChEMBL | P55072 | 7.15 ~70.8 nM | 412.5 Da LogP 3.09 TPSA 97.9 | ✓ Ro5 | ✓ Clean |
Cc1cc2c(C(N)=O)cccc2n1-c1nc2c(c(NCc3ccccc3)n1)C…
|
| CHEMBL5198263 ChEMBL | P55072 | 7.14 ~72.4 nM | 485.4 Da LogP 2.19 TPSA 121.5 | ✓ Ro5 | ✓ Clean |
CCONC(=O)c1cccc2c1cc(C)n2-c1nc2c(c(NCc3cccc(B(O…
|
| CHEMBL3746353 ChEMBL | P55072 | 7.12 ~75.9 nM | 385.5 Da LogP 4.32 TPSA 64.9 | ✓ Ro5 | ✓ Clean |
COc1nc2ccccc2n1-c1nc2c(c(NCc3ccccc3)n1)CCCC2
|
| CHEMBL5903736 ChEMBL | P55072 | 7.09 ~81.3 nM | 420.6 Da LogP 4.94 TPSA 34.3 | ✓ Ro5 | ✓ Clean |
Cc1ccc(N2CCC(NC3CCN(C)CC3)CC2)cc1-c1cc2cc(F)ccc…
|
| CHEMBL4455739 ChEMBL | P55072 | 7.08 ~83.2 nM | 425.5 Da LogP 4.71 TPSA 85.8 | ✓ Ro5 | ✓ Clean |
Cc1cc2c(C(N)=O)cccc2n1-c1nc2c(c(NCc3ccccc3)n1)C…
|
| CHEMBL5893353 ChEMBL | P55072 | 7.07 ~85.1 nM | 484.7 Da LogP 4.60 TPSA 61.3 | ✓ Ro5 | ✓ Clean |
Cc1ccc(N2CCC(NCCN3CCN(C(C)C)CC3)CC2)cc1-c1cc2cc…
|
| CHEMBL6010728 ChEMBL | P55072 | 7.06 ~87.1 nM | 488.7 Da LogP 3.52 TPSA 80.6 | ✓ Ro5 | ✓ Clean |
CC(C)N1CCN(CCNC2CCN(c3cccc(-c4cc5cc(C(N)=O)ccc5…
|
| CHEMBL4872975 ChEMBL | P55072 | 7.05 ~89.1 nM | 493.4 Da LogP 2.86 TPSA 112.3 | ✓ Ro5 | ✓ Clean |
CC#CC(=O)Nc1cccc2c1cc(C)n2-c1nc2c(c(NCc3cccc(B(…
|
| CHEMBL4876550 ChEMBL | P55072 | 7.05 ~89.1 nM | 501.4 Da LogP 2.55 TPSA 129.4 | 1 viol. | ✓ Clean |
Cc1cc2c(NS(C)(=O)=O)cccc2n1-c1nc(NCc2cccc(B(O)O…
|
| CHEMBL4848009 ChEMBL | P55072 | 7.04 ~91.2 nM | 465.3 Da LogP 2.08 TPSA 112.3 | ✓ Ro5 | ✓ Clean |
C#CC(=O)Nc1cccc2c1cc(C)n2-c1nc2c(c(NCc3cccc(B(O…
|
| CHEMBL4871208 ChEMBL | P55072 | 7.04 ~91.2 nM | 523.4 Da LogP 2.94 TPSA 134.7 | 1 viol. | ✓ Clean |
Cc1cc2c(NC(=O)c3ccco3)cccc2n1-c1nc2c(c(NCc3cccc…
|
| CHEMBL6015615 ChEMBL | P55072 | 7.04 ~91.2 nM | 451.1 Da LogP 5.92 TPSA 34.3 | 1 viol. | ✓ Clean |
CC(C)N1CCC(NC2CCN(c3cccc(-c4cc5cc(Cl)ccc5[nH]4)…
|
| CHEMBL4859176 ChEMBL | P55072 | 7.03 ~93.3 nM | 521.4 Da LogP 3.74 TPSA 125.4 | 1 viol. | ✓ Clean |
Cc1cc2c(NC(=O)c3ccco3)cccc2n1-c1nc2c(c(NCc3cccc…
|
| CHEMBL3746650 ChEMBL | P55072 | 7.02 ~95.5 nM | 413.5 Da LogP 3.68 TPSA 92.1 | ✓ Ro5 | ✓ Clean |
Cc1cc2c(C(=O)O)cccc2n1-c1nc2c(c(NCc3ccccc3)n1)C…
|
| CHEMBL5176940 ChEMBL | P55072 | 7.02 ~95.5 nM | 453.5 Da LogP 5.05 TPSA 92.1 | 1 viol. | ✓ Clean |
C/C=C/C(=O)Nc1cccc2c1cc(C)n2-c1nc2c(c(NCc3cccc(…
|
| CHEMBL3747498 ChEMBL | P55072 | 7.01 ~97.7 nM | 369.5 Da LogP 4.61 TPSA 55.6 | ✓ Ro5 | ✓ Clean |
Cc1nc2ccccc2n1-c1nc2c(c(NCc3ccccc3)n1)CCCC2
|
| CHEMBL4847081 ChEMBL | P55072 | 7.01 ~97.7 nM | 497.3 Da LogP 2.87 TPSA 134.7 | ✓ Ro5 | ✓ Clean |
COc1cnc(-n2c(C)cc3c(NC(=O)c4ccco4)cccc32)nc1NCc…
|
| CHEMBL5175776 ChEMBL | P55072 | 7.01 ~97.7 nM | 463.6 Da LogP 3.91 TPSA 109.1 | ✓ Ro5 | ✓ Clean |
Cc1cc2c(NS(C)(=O)=O)cccc2n1-c1nc2c(c(NCc3cccc(O…
|
| CHEMBL4280546 ChEMBL | P55072 | 7.00 ~100.0 nM | 445.7 Da LogP 4.42 TPSA 37.5 | ✓ Ro5 | ✓ Clean |
CC(C)N1CCN(CCNC2CCN(c3cccc(-c4cc5ccccc5[nH]4)c3…
|
| CHEMBL4291440 ChEMBL | P55072 | 7.00 ~100.0 nM | 503.7 Da LogP 5.48 TPSA 37.5 | 2 viol. | ✓ Clean |
CC(C)N1CCN(C2(CNC3CCN(c4cccc(-c5cc6cc(F)ccc6[nH…
|
| CHEMBL4573319 ChEMBL | P55072 | 7.00 ~100.0 nM | 517.5 Da LogP 4.68 TPSA 98.1 | 1 viol. | ✓ Clean |
Cc1cc2c(NS(=O)(=O)C(F)(F)F)cccc2n1-c1nc2c(c(NCc…
|
| CHEMBL5780988 ChEMBL | P55072 | 7.00 ~100.0 nM | 461.7 Da LogP 4.12 TPSA 57.8 | ✓ Ro5 | ✓ Clean |
CC(C)N1CCN(CCNC2CCN(c3cccc(-c4cc5cc(O)ccc5[nH]4…
|
| CHEMBL5845840 ChEMBL | P55072 | 7.00 ~100.0 nM | 524.8 Da LogP 5.52 TPSA 61.3 | 2 viol. | ✓ Clean |
Cc1ccc(N2CCC(NCC3(N4CCN(C(C)C)CC4)CCC3)CC2)cc1-…
|
| CHEMBL3746912 ChEMBL | P55072 | 6.96 ~109.6 nM | 396.5 Da LogP 4.17 TPSA 90.9 | ✓ Ro5 | ✓ Clean |
COc1cccc2c(NCc3ccccc3)nc(-n3c(N)nc4ccccc43)nc12
|
| CHEMBL5798108 ChEMBL | P55072 | 6.96 ~109.6 nM | 512.7 Da LogP 4.06 TPSA 70.6 | 1 viol. | ✓ Clean |
CC(C)N1CCN(C2(CNC3CCN(c4cccc(-c5cc6cc(C#N)ccc6[…
|
| CHEMBL5862582 ChEMBL | P55072 | 6.96 ~109.6 nM | 459.7 Da LogP 4.81 TPSA 37.5 | ✓ Ro5 | ✓ Clean |
CCC(C)N1CCN(CCNC2CCN(c3cccc(-c4cc5ccccc5[nH]4)c…
|
| CHEMBL5913286 ChEMBL | P55072 | 6.96 ~109.6 nM | 455.7 Da LogP 5.45 TPSA 58.1 | 1 viol. | ✓ Clean |
Cc1ccc(N2CCC(NC3CCN(C(C)C)CC3)CC2)cc1-c1cc2cc(C…
|
| CHEMBL6049771 ChEMBL | P55072 | 6.96 ~109.6 nM | 492.1 Da LogP 5.22 TPSA 37.5 | 1 viol. | ✓ Clean |
CN1CCN(C2(CNC3CCN(c4cccc(-c5cc6cc(Cl)ccc6[nH]5)…
|
| CHEMBL4864700 ChEMBL | P55072 | 6.94 ~114.8 nM | 489.3 Da LogP 3.14 TPSA 112.3 | ✓ Ro5 | ✓ Clean |
CC#CC(=O)Nc1cccc2c1cc(C)n2-c1nc(NCc2cccc(B(O)O)…
|
| CHEMBL4858094 ChEMBL | P55072 | 6.93 ~117.5 nM | 507.4 Da LogP 1.47 TPSA 138.6 | 1 viol. | ✓ Clean |
Cc1cc2c(NS(C)(=O)=O)cccc2n1-c1nc2c(c(NCc3cccc(B…
|
| CHEMBL4877447 ChEMBL | P55072 | 6.93 ~117.5 nM | 495.3 Da LogP 2.06 TPSA 121.5 | ✓ Ro5 | ✓ Clean |
CC#CC(=O)Nc1cccc2c1cc(C)n2-c1nc2c(c(NCc3cccc(B(…
|
| CHEMBL4276697 ChEMBL | P55072 | 6.92 ~120.2 nM | 491.7 Da LogP 4.48 TPSA 54.6 | ✓ Ro5 | ✓ Clean |
CC(C)N1CCN(C(=O)CCNC2CCN(c3cccc(-c4cc5cc(F)ccc5…
|
| CHEMBL4439188 ChEMBL | P55072 | 6.92 ~120.2 nM | 439.6 Da LogP 5.10 TPSA 85.8 | 1 viol. | ✓ Clean |
Cc1cc2c(C(N)=O)cccc2n1-c1nc2c(c(NCc3ccccc3)n1)C…
|
| CHEMBL5931306 ChEMBL | P55072 | 6.92 ~120.2 nM | 480.1 Da LogP 5.07 TPSA 37.5 | 1 viol. | ✓ Clean |
CC(C)N1CCN(CCNC2CCN(c3cccc(-c4cc5cc(Cl)ccc5[nH]…
|
| CHEMBL4288427 ChEMBL | P55072 | 6.89 ~128.8 nM | 459.7 Da LogP 4.81 TPSA 37.5 | ✓ Ro5 | ✓ Clean |
CC(C)(C)N1CCN(CCNC2CCN(c3cccc(-c4cc5ccccc5[nH]4…
|
| CHEMBL4530376 ChEMBL | P55072 | 6.89 ~128.8 nM | 427.5 Da LogP 4.37 TPSA 81.1 | ✓ Ro5 | ✓ Clean |
CC(=O)Nc1cccc2c1cc(C)n2-c1nc2c(c(NCc3ccccc3)n1)…
|
| CHEMBL5810576 ChEMBL | P55072 | 6.89 ~128.8 nM | 413.6 Da LogP 4.36 TPSA 58.1 | ✓ Ro5 | ✓ Clean |
CN1CCC(NC2CCN(c3cccc(-c4cc5cc(C#N)ccc5[nH]4)c3)…
|
| CHEMBL5870048 ChEMBL | P55072 | 6.89 ~128.8 nM | 416.6 Da LogP 5.27 TPSA 34.3 | 1 viol. | ✓ Clean |
CC(C)N1CCC(NC2CCN(c3cccc(-c4cc5ccccc5[nH]4)c3)C…
|
| CHEMBL4461462 ChEMBL | P55072 | 6.87 ~134.9 nM | 525.6 Da LogP 5.21 TPSA 98.1 | 2 viol. | ✓ Clean |
Cc1cc2c(NS(=O)(=O)c3ccccc3)cccc2n1-c1nc2c(c(NCc…
|
| CHEMBL5819590 ChEMBL | P55072 | 6.85 ~141.3 nM | 457.7 Da LogP 4.56 TPSA 37.5 | ✓ Ro5 | ✓ Clean |
CN1CCN(C2(CNC3CCN(c4cccc(-c5cc6ccccc6[nH]5)c4)C…
|
| CHEMBL5861026 ChEMBL | P55072 | 6.85 ~141.3 nM | 459.7 Da LogP 4.73 TPSA 37.5 | ✓ Ro5 | ✓ Clean |
Cc1ccc(N2CCC(NCCN3CCN(C(C)C)CC3)CC2)cc1-c1cc2cc…
|
| CHEMBL5946783 ChEMBL | P55072 | 6.85 ~141.3 nM | 445.7 Da LogP 4.42 TPSA 37.5 | ✓ Ro5 | ✓ Clean |
C[C@@H]1CN(CCNC2CCN(c3cccc(-c4cc5ccccc5[nH]4)c3…
|
| CHEMBL5963984 ChEMBL | P55072 | 6.85 ~141.3 nM | 473.7 Da LogP 4.34 TPSA 54.6 | ✓ Ro5 | ✓ Clean |
CC(C)N1CCN(C(=O)CCNC2CCN(c3cccc(-c4cc5ccccc5[nH…
|
| CHEMBL3746000 ChEMBL | P55072 | 6.84 ~144.5 nM | 394.5 Da LogP 3.86 TPSA 78.6 | ✓ Ro5 | ✓ Clean |
Cc1cc2c(C#N)cccc2n1-c1nc2c(c(NCc3ccccc3)n1)CNCC2
|
| CHEMBL3696861 ChEMBL | P55072 | 6.82 ~151.4 nM | 395.5 Da LogP 4.90 TPSA 64.9 | ✓ Ro5 | ✓ Clean |
COc1cccc2c(NCc3ccccc3)nc(-n3c(C)nc4ccccc43)nc12
|
| CHEMBL3696917 ChEMBL | P55072 | 6.82 ~151.4 nM | 383.5 Da LogP 4.37 TPSA 68.8 | ✓ Ro5 | ✓ Clean |
NCc1cc2ccccc2n1-c1nc2c(c(NCc3ccccc3)n1)CCCC2
|
| CHEMBL5751058 ChEMBL | P55072 | 6.82 ~151.4 nM | 503.7 Da LogP 4.21 TPSA 63.8 | 1 viol. | ✓ Clean |
COC(=O)c1ccc2[nH]c(-c3cccc(N4CCC(NCCN5CCN(C(C)C…
|
| CHEMBL5783148 ChEMBL | P55072 | 6.82 ~151.4 nM | 459.7 Da LogP 4.81 TPSA 37.5 | ✓ Ro5 | ✓ Clean |
CC(C)N1CCCN(CCNC2CCN(c3cccc(-c4cc5ccccc5[nH]4)c…
|
| CHEMBL5889892 ChEMBL | P55072 | 6.82 ~151.4 nM | 498.7 Da LogP 4.21 TPSA 78.4 | ✓ Ro5 | ✓ Clean |
CC(C)N1CCN(C(=O)CCNC2CCN(c3cccc(-c4cc5cc(C#N)cc…
|
| CHEMBL6032099 ChEMBL | P55072 | 6.82 ~151.4 nM | 463.6 Da LogP 3.70 TPSA 54.6 | ✓ Ro5 | ✓ Clean |
CN1CCN(C(=O)CCNC2CCN(c3cccc(-c4cc5cc(F)ccc5[nH]…
|
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC19589796 ZINC | 1.000 | 240.3 Da LogP 1.35 TPSA 23.6 | ✓ Ro5 | ✓ Clean |
CN1CCN(C(=O)c2ccc(F)c(F)c2)CC1
|
| ZINC263620729 ZINC | 1.000 | 463.6 Da LogP 4.56 TPSA 37.5 | ✓ Ro5 | ✓ Clean |
CC(C)N1CCN(CCNC2CCN(c3cccc(-c4cc5cc(F)ccc5[nH]4…
|
| ZINC386890 ZINC | 1.000 | 237.3 Da LogP 1.60 TPSA 35.6 | ✓ Ro5 | ✓ Clean |
CN1CCN(C(=O)Nc2ccc(F)cc2)CC1
|
| ZINC527883 ZINC | 1.000 | 222.3 Da LogP 1.86 TPSA 32.3 | ✓ Ro5 | ✓ Clean |
O=C(CN1CCCC1)Nc1ccc(F)cc1
|
| ZINC96021026 ZINC | 1.000 | 396.5 Da LogP 4.17 TPSA 90.9 | ✓ Ro5 | ✓ Clean |
COc1cccc2c(NCc3ccccc3)nc(-n3c(N)nc4ccccc43)nc12
|
| ZINC5050219 ZINC | 0.968 | 236.3 Da LogP 2.25 TPSA 32.3 | ✓ Ro5 | ✓ Clean |
O=C(CN1CCCCC1)Nc1ccc(F)cc1
|
| ZINC6086209 ZINC | 0.968 | 250.3 Da LogP 2.64 TPSA 32.3 | ✓ Ro5 | ✓ Clean |
O=C(CN1CCCCCC1)Nc1ccc(F)cc1
|
| ZINC22036805 ZINC | 0.906 | 402.4 Da LogP 2.55 TPSA 64.7 | ✓ Ro5 | ✓ Clean |
O=C(CN1CCCN(CC(=O)Nc2ccc(F)cc2)CC1)Nc1ccc(F)cc1
|
| ZINC20514821 ZINC | 0.882 | 251.3 Da LogP 2.00 TPSA 35.6 | ✓ Ro5 | ✓ Clean |
CN1CCCN(C(=O)Nc2ccc(F)cc2)CC1
|
| ZINC20767131 ZINC | 0.871 | 388.4 Da LogP 2.16 TPSA 64.7 | ✓ Ro5 | ✓ Clean |
O=C(CN1CCN(CC(=O)Nc2ccc(F)cc2)CC1)Nc1ccc(F)cc1
|
| ZINC4806433 ZINC | 0.855 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CO[P@@](=O)(O)OP(=O…
|
| ZINC24978501 ZINC | 0.844 | 313.7 Da LogP 3.44 TPSA 82.0 | ✓ Ro5 | ✓ Clean |
N#CCC(=O)Nc1ccc(C(=O)Nc2ccc(Cl)cc2)cc1
|
| ZINC12843533 ZINC | 0.833 | 369.4 Da LogP 3.43 TPSA 61.4 | ✓ Ro5 | ✓ Clean |
O=C(Cc1ccc(F)cc1)Nc1ccc(NC(=O)CN2CCCCC2)cc1
|
| ZINC51126492 ZINC | 0.833 | 362.4 Da LogP 2.69 TPSA 66.5 | ✓ Ro5 | ✓ Clean |
O=C(CN1CCCC1)Nc1ccc(S(=O)(=O)c2ccc(F)cc2)cc1
|
| ZINC7340167 ZINC | 0.833 | 330.4 Da LogP 1.76 TPSA 64.7 | ✓ Ro5 | ✓ Clean |
O=C(CN1CCCC1)Nc1ccc(NC(=O)CN2CCCC2)cc1
|
| ZINC198557392 ZINC | 0.821 | 410.5 Da LogP 4.48 TPSA 90.9 | ✓ Ro5 | ✓ Clean |
COc1cccc2c(NCc3ccccc3)nc(-n3c(N)nc4c(C)cccc43)n…
|
| ZINC208076131 ZINC | 0.815 | 413.5 Da LogP 3.51 TPSA 95.1 | ✓ Ro5 | ✓ Clean |
Cc1cc2c(C(N)=O)cccc2n1-c1nc2c(c(NCc3ccccc3)n1)C…
|
| ZINC12360002 ZINC | 0.810 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CO[P@@](=O)(O)OP(=O…
|
| ZINC12360703 ZINC | 0.810 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CO[P@@](=O)(O)OP(=O…
|
| ZINC12503599 ZINC | 0.810 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CO[P@@](=O)(O)OP(=O…
|
| ZINC16546165 ZINC | 0.810 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@H](CO[P@](=O)(O)OP(=O)(…
|
| ZINC31977053 ZINC | 0.810 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](CO[P@](=O)(O)OP(=O)…
|
| ZINC53683898 ZINC | 0.810 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](CO[P@@](=O)(O)OP(=…
|
| ZINC8586019 ZINC | 0.810 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](CO[P@](=O)(O)OP(=O)…
|
| ZINC8586020 ZINC | 0.810 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](CO[P@@](=O)(O)OP(=…
|
| ZINC8586021 ZINC | 0.810 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](CO[P@@](=O)(O)OP(=O…
|
| ZINC8586022 ZINC | 0.810 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](CO[P@@](=O)(O)OP(=…
|
| ZINC198557555 ZINC | 0.807 | 414.4 Da LogP 4.31 TPSA 90.9 | ✓ Ro5 | ✓ Clean |
COc1cccc2c(NCc3ccccc3)nc(-n3c(N)nc4c(F)cccc43)n…
|
| ZINC1029687 ZINC | 0.806 | 358.5 Da LogP 2.54 TPSA 64.7 | ✓ Ro5 | ✓ Clean |
O=C(CN1CCCCC1)Nc1ccc(NC(=O)CN2CCCCC2)cc1
|
| ZINC3433909 ZINC | 0.806 | 279.3 Da LogP 0.98 TPSA 61.4 | ✓ Ro5 | ✓ Clean |
O=C(CN1CCCC1)NCC(=O)Nc1ccc(F)cc1
|
| ZINC32731168 ZINC | 0.788 | 268.3 Da LogP 1.27 TPSA 40.6 | ✓ Ro5 | ✓ Clean |
CC(=O)N1CCN(C(=O)c2ccc(F)c(F)c2)CC1
|
| ZINC19371019 ZINC | 0.771 | 237.3 Da LogP 0.67 TPSA 44.4 | ✓ Ro5 | ✓ Clean |
O=C(CN1CCNCC1)Nc1ccc(F)cc1
|
| ZINC32780612 ZINC | 0.771 | 236.3 Da LogP 1.52 TPSA 23.6 | ✓ Ro5 | ✓ Clean |
Cc1ccc(C(=O)N2CCN(C)CC2)cc1F
|
| ZINC19539258 ZINC | 0.763 | 376.5 Da LogP 1.78 TPSA 55.9 | ✓ Ro5 | ✓ Clean |
O=C(CN1CCN(CC(=O)N2CCCCCC2)CC1)Nc1ccc(F)cc1
|
| ZINC54225138 ZINC | 0.763 | 348.4 Da LogP 1.99 TPSA 55.9 | ✓ Ro5 | ✓ Clean |
O=C(CN1CCN(C(=O)N2CCCCC2)CC1)Nc1ccc(F)cc1
|
| ZINC84405653 ZINC | 0.763 | 467.6 Da LogP 3.40 TPSA 67.9 | ✓ Ro5 | Alert |
O=C(CN1CCN(CC(=O)Nc2ccc(N3CCCCCC3)cc2)CC1)Nc1cc…
|
| ZINC5715371 ZINC | 0.758 | 374.4 Da LogP 3.74 TPSA 64.7 | ✓ Ro5 | ✓ Clean |
O=C(Nc1ccc(F)cc1)N1CCCN(C(=O)Nc2ccc(F)cc2)CC1
|
| ZINC19335457 ZINC | 0.750 | 238.3 Da LogP 1.10 TPSA 41.6 | ✓ Ro5 | ✓ Clean |
O=C(CN1CCOCC1)Nc1ccc(F)cc1
|
| ZINC19811049 ZINC | 0.750 | 251.3 Da LogP 1.01 TPSA 35.6 | ✓ Ro5 | ✓ Clean |
CN1CCN(CC(=O)Nc2ccc(F)cc2)CC1
|
| ZINC22459737 ZINC | 0.750 | 265.3 Da LogP 1.40 TPSA 35.6 | ✓ Ro5 | ✓ Clean |
CCN1CCN(CC(=O)Nc2ccc(F)cc2)CC1
|
| ZINC43578599 ZINC | 0.750 | 301.2 Da LogP 1.98 TPSA 23.6 | ✓ Ro5 | ✓ Clean |
CN1CCN(C(=O)c2ccc(Br)c(F)c2)CC1
|
| ZINC828052385 ZINC | 0.750 | 385.4 Da LogP 3.27 TPSA 70.7 | ✓ Ro5 | ✓ Clean |
O=C(COc1ccc(F)cc1)Nc1ccc(NC(=O)CN2CCCCC2)cc1
|
| ZINC29157827 ZINC | 0.744 | 333.4 Da LogP 2.10 TPSA 52.7 | ✓ Ro5 | ✓ Clean |
O=C(CN1CCC(C(=O)N2CCCC2)CC1)Nc1ccc(F)cc1
|
| ZINC58172409 ZINC | 0.744 | 410.5 Da LogP 3.97 TPSA 38.8 | ✓ Ro5 | Alert |
O=C(CN1CCN(c2ccc(F)cc2)CC1)Nc1ccc(N2CCCCCC2)cc1
|
| ZINC13518964 ZINC | 0.741 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](COP(=O)(O)O)[C@H](…
|
| ZINC1842158 ZINC | 0.741 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](COP(=O)(O)O)[C@H](O…
|
| ZINC2046931 ZINC | 0.741 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](COP(=O)(O)O)[C@H](…
|
| ZINC2126310 ZINC | 0.741 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](COP(=O)(O)O)[C@@H](…
|
| ZINC3977897 ZINC | 0.741 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@H](COP(=O)(O)O)[C@@H](O…
|
| ZINC8613167 ZINC | 0.741 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](COP(=O)(O)O)[C@H](O…
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.