Strong target candidate with converging metabolic, structural and chemical evidence.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Evidence coverage
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- No hit
- Gut microbiome similarity
- 8.3% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- Y
- DEG identity (%)
- 42.254 Higher values support similarity to known essential genes.
- DEG E-value
- 5.85e-35 Smaller values mean stronger essential-gene similarity.
Structure confidence
- ColabFold pLDDT
- 94.58 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
PDB experimental structureP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MSKTEFYADLNRDFQALMASETSFLAMIANTSALLFERLSEVNWVGFYLLEGDTLVLGPFQGKLACVRIPVGRGVCGAAVAQAQVQRVEDVHAFDGHIACDAASNSEIVFPLRVNGQIIGVLDIDSPAYGRFTAEDEQGLRTLVEHLEKLIAATDYQKIFTRVVG
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- Unknown
Gene Ontology (GO)
4- GO:0005515 Binding to a protein.
- GO:0005829 The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
- GO:0033745 Catalysis of the reaction: [thioredoxin]-disulfide + L-methionine + H2O = L-methionine (R)-S-oxide + [thioredoxin]-dithiol.
- GO:0046872 Binding to a metal ion.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 90 | 107 | ProSitePatterns | PS01320 | Uncharacterized protein family UPF0067 signature. |
| 90 | 107 | InterPro | IPR000614 | Free Met sulfoxide reductase conserved site |
| 28 | 162 | PANTHER | PTHR21021 | GAF/PUTATIVE CYTOSKELETAL PROTEIN |
| 1 | 152 | FunFam | G3DSA:3.30.450.40:FF:000008 | GAF domain-containing proteins |
| 9 | 161 | SMART | SM00065 | gaf_1 |
| 9 | 161 | InterPro | IPR003018 | GAF domain |
| 1 | 152 | Gene3D | G3DSA:3.30.450.40 | - |
| 1 | 152 | InterPro | IPR029016 | GAF-like domain superfamily |
| 38 | 150 | Pfam | PF13185 | GAF domain |
| 38 | 150 | InterPro | IPR003018 | GAF domain |
| 2 | 147 | SUPERFAMILY | SSF55781 | GAF domain-like |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Residue sets
All structural evidence
Structural evidence
1 + 1Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural ligand evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC308411996 ZINC | 0.581 | 221.3 Da LogP 0.42 TPSA 69.4 | ✓ Ro5 | ✓ Clean |
C[S@@](=O)CC[C@H](N)C(=O)OC(C)(C)C
|
| ZINC308411998 ZINC | 0.581 | 221.3 Da LogP 0.42 TPSA 69.4 | ✓ Ro5 | ✓ Clean |
C[S@](=O)CC[C@H](N)C(=O)OC(C)(C)C
|
| ZINC5759012 ZINC | 0.581 | 207.3 Da LogP 0.34 TPSA 80.4 | ✓ Ro5 | ✓ Clean |
CCCC[S@@](=O)CC[C@H](N)C(=O)O
|
| ZINC5759013 ZINC | 0.581 | 207.3 Da LogP 0.34 TPSA 80.4 | ✓ Ro5 | ✓ Clean |
CCCC[S@](=O)CC[C@H](N)C(=O)O
|
| ZINC5759014 ZINC | 0.581 | 207.3 Da LogP 0.34 TPSA 80.4 | ✓ Ro5 | ✓ Clean |
CCCC[S@@](=O)CC[C@@H](N)C(=O)O
|
| ZINC5759015 ZINC | 0.581 | 207.3 Da LogP 0.34 TPSA 80.4 | ✓ Ro5 | ✓ Clean |
CCCC[S@](=O)CC[C@@H](N)C(=O)O
|
| ZINC3055005 ZINC | 0.520 | 204.2 Da LogP -0.63 TPSA 126.6 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCCC[C@H](N)C(=O)O)C(=O)O
|
| ZINC3055007 ZINC | 0.520 | 204.2 Da LogP -0.63 TPSA 126.6 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCCC[C@@H](N)C(=O)O)C(=O)O
|
| ZINC3055010 ZINC | 0.520 | 204.2 Da LogP -0.63 TPSA 126.6 | ✓ Ro5 | ✓ Clean |
N[C@H](CCCC[C@@H](N)C(=O)O)C(=O)O
|
| ZINC1555366 ZINC | 0.500 | 232.3 Da LogP 0.15 TPSA 126.6 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCCCCC[C@H](N)C(=O)O)C(=O)O
|
| ZINC1555367 ZINC | 0.500 | 232.3 Da LogP 0.15 TPSA 126.6 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCCCCC[C@@H](N)C(=O)O)C(=O)O
|
| ZINC1555369 ZINC | 0.500 | 232.3 Da LogP 0.15 TPSA 126.6 | ✓ Ro5 | ✓ Clean |
N[C@H](CCCCCC[C@@H](N)C(=O)O)C(=O)O
|
| ZINC1720127 ZINC | 0.500 | 218.3 Da LogP -0.24 TPSA 126.6 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCCCC[C@H](N)C(=O)O)C(=O)O
|
| ZINC1720128 ZINC | 0.500 | 218.3 Da LogP -0.24 TPSA 126.6 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCCCC[C@@H](N)C(=O)O)C(=O)O
|
| ZINC1720130 ZINC | 0.500 | 218.3 Da LogP -0.24 TPSA 126.6 | ✓ Ro5 | ✓ Clean |
N[C@H](CCCCC[C@@H](N)C(=O)O)C(=O)O
|
| ZINC4642766 ZINC | 0.500 | 201.2 Da LogP -0.78 TPSA 100.6 | ✓ Ro5 | ✓ Clean |
C[S@@](=O)CC[C@@H](N)P(=O)(O)O
|
| ZINC4642767 ZINC | 0.500 | 201.2 Da LogP -0.78 TPSA 100.6 | ✓ Ro5 | ✓ Clean |
C[S@](=O)CC[C@@H](N)P(=O)(O)O
|
| ZINC4899638 ZINC | 0.500 | 207.3 Da LogP -0.66 TPSA 83.5 | ✓ Ro5 | ✓ Clean |
CC(=O)N[C@@H](CC[S@](C)=O)C(=O)O
|
| ZINC4899639 ZINC | 0.500 | 207.3 Da LogP -0.66 TPSA 83.5 | ✓ Ro5 | ✓ Clean |
CC(=O)N[C@@H](CC[S@@](C)=O)C(=O)O
|
| ZINC5431484 ZINC | 0.500 | 207.3 Da LogP -0.66 TPSA 83.5 | ✓ Ro5 | ✓ Clean |
CC(=O)N[C@H](CC[S@](C)=O)C(=O)O
|
| ZINC5431485 ZINC | 0.500 | 207.3 Da LogP -0.66 TPSA 83.5 | ✓ Ro5 | ✓ Clean |
CC(=O)N[C@H](CC[S@@](C)=O)C(=O)O
|
| ZINC5519141 ZINC | 0.500 | 201.2 Da LogP -0.78 TPSA 100.6 | ✓ Ro5 | ✓ Clean |
C[S@@](=O)CC[C@H](N)P(=O)(O)O
|
| ZINC5519143 ZINC | 0.500 | 201.2 Da LogP -0.78 TPSA 100.6 | ✓ Ro5 | ✓ Clean |
C[S@](=O)CC[C@H](N)P(=O)(O)O
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.