Promising target candidate with multiple supporting evidence streams.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- Hit
- Human identity (%)
- 35.227 Lower values reduce human off-target concern.
- Human E-value
- 2.63e-20
- Gut microbiome similarity
- 4.9% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- Y
- DEG identity (%)
- 91.753 Higher values support similarity to known essential genes.
- DEG E-value
- 1.11e-125 Smaller values mean stronger essential-gene similarity.
Localization
- Localization
- Cytoplasmic
Structure confidence
- ColabFold pLDDT
- 97.31 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
PDB experimental structureThe selected pocket score is the FPocket value used for ranking after applying the curated structure priority. It estimates small-molecule pocket quality; it is not experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.
Sequence
Structure
Sequence
Primary amino-acid sequence viewer.
MTIKLIVGLANPGAEYAATRHNAGAWYVDLLADRHRAPLREESKFFGYTSRINLAGEDVRLLVPTTFMNLSGKAVAAMATFYRINPDEILVAHDELDLPPGVAKFKLGGGHGGHNGLKDIISKLGNNPNFHRLRVGIGHPGDKNKVVGFVLGKPPASEQKLIDDAVDEAARCTEIWLKDGLTKATNRLHAFKAQ
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Gene Ontology (GO)
1- GO:0004045 Catalysis of the reaction: an N-acyl-L-alpha-aminoacyl-tRNA + H2O = an N-acyl-L-amino acid + a tRNA + H+.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 4 | 175 | NCBIfam | TIGR00447 | aminoacyl-tRNA hydrolase |
| 4 | 175 | InterPro | IPR001328 | Peptidyl-tRNA hydrolase |
| 1 | 194 | Gene3D | G3DSA:3.40.50.1470 | - |
| 1 | 194 | InterPro | IPR036416 | Peptidyl-tRNA hydrolase superfamily |
| 3 | 182 | Hamap | MF_00083 | Peptidyl-tRNA hydrolase [pth]. |
| 3 | 182 | InterPro | IPR001328 | Peptidyl-tRNA hydrolase |
| 110 | 120 | ProSitePatterns | PS01196 | Peptidyl-tRNA hydrolase signature 2. |
| 110 | 120 | InterPro | IPR018171 | Peptidyl-tRNA hydrolase, conserved site |
| 4 | 187 | PANTHER | PTHR17224 | PEPTIDYL-TRNA HYDROLASE |
| 4 | 187 | InterPro | IPR001328 | Peptidyl-tRNA hydrolase |
| 5 | 177 | CDD | cd00462 | PTH |
| 5 | 177 | InterPro | IPR001328 | Peptidyl-tRNA hydrolase |
| 16 | 29 | ProSitePatterns | PS01195 | Peptidyl-tRNA hydrolase signature 1. |
| 16 | 29 | InterPro | IPR018171 | Peptidyl-tRNA hydrolase, conserved site |
| 3 | 192 | SUPERFAMILY | SSF53178 | Peptidyl-tRNA hydrolase-like |
| 3 | 192 | InterPro | IPR036416 | Peptidyl-tRNA hydrolase superfamily |
| 1 | 192 | FunFam | G3DSA:3.40.50.1470:FF:000001 | Peptidyl-tRNA hydrolase |
| 5 | 189 | Pfam | PF01195 | Peptidyl-tRNA hydrolase |
| 5 | 189 | InterPro | IPR001328 | Peptidyl-tRNA hydrolase |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · FPocket
Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Residue sets
All structural evidence
Structural evidence
1 + 1Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural ligand evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| 0L1 RCSB PDB | Q9HVC3 | 146.1 Da LogP 0.72 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
C(CCC(=O)O)CC(=O)O
|
|
| 3NZ RCSB PDB | Q9HVC3 | 443.5 Da LogP -1.28 TPSA 183.7 | 1 viol. | ✓ Clean |
COc1ccc(cc1)C[C@@H](C(=O)N[C@@H]2[C@H](O[C@H]([…
|
|
| 5AE RCSB PDB | Q9HVC3 | 244.2 Da LogP -3.17 TPSA 143.7 | ✓ Ro5 | ✓ Clean |
C1=NC(=NC(=O)N1[C@H]2[C@@H]([C@@H]([C@H](O2)CO)…
|
|
| AR3 RCSB PDB | D0C9L6 | 243.2 Da LogP -2.56 TPSA 130.8 | ✓ Ro5 | ✓ Clean |
C1=CN(C(=O)N=C1N)[C@H]2[C@H]([C@@H]([C@H](O2)CO…
|
|
| CTN RCSB PDB | D0C9L6 | 243.2 Da LogP -2.56 TPSA 130.8 | ✓ Ro5 | ✓ Clean |
C1=CN(C(=O)N=C1N)[C@H]2[C@@H]([C@@H]([C@H](O2)C…
|
|
| FLC RCSB PDB | Q5SHZ2 | 189.1 Da LogP -5.25 TPSA 140.6 | ✓ Ro5 | ✓ Clean |
C(C(=O)[O-])C(CC(=O)[O-])(C(=O)[O-])O
|
|
| PML RCSB PDB | Q9HVC3 | 160.2 Da LogP 1.11 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
C(CCC(=O)O)CCC(=O)O
|
|
| POL RCSB PDB | D0C9L6 | 60.1 Da LogP 0.39 TPSA 20.2 | ✓ Ro5 | ✓ Clean |
CCCO
|
|
| TLA RCSB PDB | D0C9L6 | 150.1 Da LogP -2.12 TPSA 115.1 | ✓ Ro5 | ✓ Clean |
[C@@H]([C@H](C(=O)O)O)(C(=O)O)O
|
|
| URI RCSB PDB | D0C9L6 | 244.2 Da LogP -2.85 TPSA 124.8 | ✓ Ro5 | ✓ Clean |
C1=CN(C(=O)NC1=O)[C@H]2[C@@H]([C@@H]([C@H](O2)C…
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC1078621 ZINC | 1.000 | 243.2 Da LogP -2.56 TPSA 130.8 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@H]2O[C@H](CO)[C@@H](O)[C@H]2O)c(=O)n1
|
| ZINC12336757 ZINC | 1.000 | 243.2 Da LogP -2.56 TPSA 130.8 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@@H]2O[C@H](CO)[C@H](O)[C@@H]2O)c(=O)n1
|
| ZINC12336758 ZINC | 1.000 | 243.2 Da LogP -2.56 TPSA 130.8 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@H]2O[C@H](CO)[C@H](O)[C@@H]2O)c(=O)n1
|
| ZINC16969357 ZINC | 1.000 | 243.2 Da LogP -2.56 TPSA 130.8 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@H]2O[C@@H](CO)[C@H](O)[C@H]2O)c(=O)n1
|
| ZINC2583632 ZINC | 1.000 | 243.2 Da LogP -2.56 TPSA 130.8 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@@H]2O[C@H](CO)[C@@H](O)[C@H]2O)c(=O)n1
|
| ZINC3795098 ZINC | 1.000 | 243.2 Da LogP -2.56 TPSA 130.8 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@@H]2O[C@H](CO)[C@@H](O)[C@@H]2O)c(=O)…
|
| ZINC3830623 ZINC | 1.000 | 243.2 Da LogP -2.56 TPSA 130.8 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@H]2O[C@@H](CO)[C@@H](O)[C@H]2O)c(=O)n1
|
| ZINC3830624 ZINC | 1.000 | 243.2 Da LogP -2.56 TPSA 130.8 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@@H]2O[C@@H](CO)[C@@H](O)[C@H]2O)c(=O)…
|
| ZINC3978018 ZINC | 1.000 | 243.2 Da LogP -2.56 TPSA 130.8 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@H]2O[C@H](CO)[C@@H](O)[C@@H]2O)c(=O)n1
|
| ZINC6091575 ZINC | 1.000 | 243.2 Da LogP -2.56 TPSA 130.8 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@@H]2O[C@H](CO)[C@H](O)[C@H]2O)c(=O)n1
|
| ZINC6234828 ZINC | 1.000 | 243.2 Da LogP -2.56 TPSA 130.8 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@H]2O[C@H](CO)[C@H](O)[C@H]2O)c(=O)n1
|
| ZINC6524892 ZINC | 1.000 | 243.2 Da LogP -2.56 TPSA 130.8 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@@H]2O[C@@H](CO)[C@H](O)[C@H]2O)c(=O)n1
|
| ZINC895248 ZINC | 1.000 | 243.2 Da LogP -2.56 TPSA 130.8 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@H]2O[C@@H](CO)[C@H](O)[C@@H]2O)c(=O)n1
|
| ZINC1529497 ZINC | 0.917 | 230.3 Da LogP 3.06 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
O=C(O)CCCCCCCCCCC(=O)O
|
| ZINC1531045 ZINC | 0.917 | 202.2 Da LogP 2.28 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
O=C(O)CCCCCCCCC(=O)O
|
| ZINC1593115 ZINC | 0.917 | 216.3 Da LogP 2.67 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
O=C(O)CCCCCCCCCC(=O)O
|
| ZINC1700020 ZINC | 0.917 | 244.3 Da LogP 3.45 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
O=C(O)CCCCCCCCCCCC(=O)O
|
| ZINC3860440 ZINC | 0.917 | 258.4 Da LogP 3.84 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
O=C(O)CCCCCCCCCCCCC(=O)O
|
| ZINC3861298 ZINC | 0.917 | 286.4 Da LogP 4.62 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
O=C(O)CCCCCCCCCCCCCCC(=O)O
|
| ZINC5113062 ZINC | 0.917 | 272.4 Da LogP 4.23 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
O=C(O)CCCCCCCCCCCCCC(=O)O
|
| ZINC34085615 ZINC | 0.829 | 242.2 Da LogP -2.60 TPSA 136.6 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@@H]2O[C@H](CO)[C@@H](O)[C@H]2N)c(=O)n1
|
| ZINC53147178 ZINC | 0.829 | 471.5 Da LogP -0.79 TPSA 160.9 | 1 viol. | ✓ Clean |
COc1ccc(C[C@@H](N)C(=O)N[C@@H]2[C@@H](CO)O[C@@H…
|
| ZINC53147179 ZINC | 0.829 | 471.5 Da LogP -0.79 TPSA 160.9 | 1 viol. | ✓ Clean |
COc1ccc(C[C@H](N)C(=O)N[C@@H]2[C@@H](CO)O[C@@H]…
|
| ZINC58994963 ZINC | 0.829 | 471.5 Da LogP -0.79 TPSA 160.9 | 1 viol. | ✓ Clean |
COc1ccc(C[C@@H](N)C(=O)N[C@@H]2[C@H](CO)O[C@@H]…
|
| ZINC59065899 ZINC | 0.829 | 471.5 Da LogP -0.79 TPSA 160.9 | 1 viol. | ✓ Clean |
COc1ccc(C[C@@H](N)C(=O)N[C@@H]2[C@H](O)[C@@H](n…
|
| ZINC59817042 ZINC | 0.829 | 471.5 Da LogP -0.79 TPSA 160.9 | 1 viol. | ✓ Clean |
COc1ccc(C[C@@H](N)C(=O)N[C@@H]2[C@H](CO)O[C@H](…
|
| ZINC59817043 ZINC | 0.829 | 471.5 Da LogP -0.79 TPSA 160.9 | 1 viol. | ✓ Clean |
COc1ccc(C[C@@H](N)C(=O)N[C@H]2[C@H](O)[C@@H](n3…
|
| ZINC59817045 ZINC | 0.829 | 471.5 Da LogP -0.79 TPSA 160.9 | 1 viol. | ✓ Clean |
COc1ccc(C[C@@H](N)C(=O)N[C@H]2[C@H](O)[C@H](n3c…
|
| ZINC61389312 ZINC | 0.829 | 471.5 Da LogP -0.79 TPSA 160.9 | 1 viol. | ✓ Clean |
COc1ccc(C[C@H](N)C(=O)N[C@@H]2[C@@H](CO)O[C@H](…
|
| ZINC71789712 ZINC | 0.829 | 471.5 Da LogP -0.79 TPSA 160.9 | 1 viol. | ✓ Clean |
COc1ccc(C[C@@H](N)C(=O)N[C@@H]2[C@@H](CO)O[C@H]…
|
| ZINC73333306 ZINC | 0.829 | 471.5 Da LogP -0.79 TPSA 160.9 | 1 viol. | ✓ Clean |
COc1ccc(C[C@H](N)C(=O)N[C@@H]2[C@H](CO)O[C@H](n…
|
| ZINC73333309 ZINC | 0.829 | 471.5 Da LogP -0.79 TPSA 160.9 | 1 viol. | ✓ Clean |
COc1ccc(C[C@H](N)C(=O)N[C@@H]2[C@H](CO)O[C@@H](…
|
| ZINC73333313 ZINC | 0.829 | 471.5 Da LogP -0.79 TPSA 160.9 | 1 viol. | ✓ Clean |
COc1ccc(C[C@H](N)C(=O)N[C@H]2[C@H](O)[C@@H](n3c…
|
| ZINC73333316 ZINC | 0.829 | 471.5 Da LogP -0.79 TPSA 160.9 | 1 viol. | ✓ Clean |
COc1ccc(C[C@H](N)C(=O)N[C@H]2[C@H](O)[C@H](n3cn…
|
| ZINC13546396 ZINC | 0.810 | 245.2 Da LogP -1.59 TPSA 110.6 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@@H]2O[C@H](CO)[C@H](O)[C@H]2F)c(=O)n1
|
| ZINC16952044 ZINC | 0.810 | 245.2 Da LogP -1.59 TPSA 110.6 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@H]2O[C@@H](CO)[C@H](O)[C@H]2F)c(=O)n1
|
| ZINC17174505 ZINC | 0.810 | 245.2 Da LogP -1.59 TPSA 110.6 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@@H]2O[C@@H](CO)[C@@H](O)[C@@H]2F)c(=O…
|
| ZINC17174506 ZINC | 0.810 | 245.2 Da LogP -1.59 TPSA 110.6 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@@H]2O[C@H](CO)[C@@H](O)[C@@H]2F)c(=O)…
|
| ZINC2522524 ZINC | 0.810 | 245.2 Da LogP -1.59 TPSA 110.6 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@H]2O[C@@H](CO)[C@H](O)[C@@H]2F)c(=O)n1
|
| ZINC3817231 ZINC | 0.810 | 245.2 Da LogP -1.59 TPSA 110.6 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@@H]2O[C@H](CO)[C@@H](O)[C@H]2F)c(=O)n1
|
| ZINC57331 ZINC | 0.810 | 245.2 Da LogP -1.59 TPSA 110.6 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@@H]2O[C@@H](CO)[C@@H](O)[C@H]2F)c(=O)…
|
| ZINC5758597 ZINC | 0.810 | 245.2 Da LogP -1.59 TPSA 110.6 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@H]2O[C@@H](CO)[C@@H](O)[C@H]2F)c(=O)n1
|
| ZINC5758598 ZINC | 0.810 | 245.2 Da LogP -1.59 TPSA 110.6 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@H]2O[C@@H](CO)[C@@H](O)[C@@H]2F)c(=O)…
|
| ZINC59201305 ZINC | 0.810 | 245.2 Da LogP -1.59 TPSA 110.6 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@@H]2O[C@H](CO)[C@H](O)[C@@H]2F)c(=O)n1
|
| ZINC4824413 ZINC | 0.806 | 413.4 Da LogP -1.29 TPSA 174.4 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](CO)[C@@H](NC(=O)[C@…
|
| ZINC4824417 ZINC | 0.806 | 413.4 Da LogP -1.29 TPSA 174.4 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](CO)[C@@H](NC(=O)[C@…
|
| ZINC4824420 ZINC | 0.806 | 413.4 Da LogP -1.29 TPSA 174.4 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](CO)[C@H](NC(=O)[C@@…
|
| ZINC4824422 ZINC | 0.806 | 413.4 Da LogP -1.29 TPSA 174.4 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](CO)[C@H](NC(=O)[C@H…
|
| ZINC195751891 ZINC | 0.800 | 246.2 Da LogP -1.87 TPSA 104.5 | ✓ Ro5 | ✓ Clean |
O=c1ccn([C@@H]2O[C@@H](CO)[C@H](O)[C@H]2F)c(=O)…
|
| ZINC34248200 ZINC | 0.800 | 243.2 Da LogP -2.89 TPSA 130.6 | ✓ Ro5 | ✓ Clean |
N[C@H]1[C@H](O)[C@H](CO)O[C@H]1n1ccc(=O)[nH]c1=O
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.