KpATCC43816 Protein target profile

cardiolipin synthase

Accession: VK055_0265

Gene: cls AIK78891.1 3D evidence: AlphaFold DB model + ColabFold model Metabolism 3 reactions UniProt A0A0H3GU90
Length 486
Pocket druggability (P2Rank · AlphaFold DB model) 0.718
Metabolic reactions 3
Chokepoint No
Functional annotation 1 EC 5 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
2.7% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
28.543 Higher values support similarity to known essential genes.

Structure confidence

ColabFold pLDDT
89.81 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.718
Structure A0A0H3GU90
Pocket Pocket 1
Druggability (FPocket) 0.412
Structure A0A0H3GU90
Pocket Pocket 5
ColabFold model
P2Rank 0.788 · Pocket 1
FPocket 0.942 · Pocket 37
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 127 / 4744 genomes with a hit
Prevalence 2.7%

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

Explore metabolic network

Metabolic context: more central than 97.7% of genes in this genome, no human homolog detected.

Relative network centrality 97.7% more central than 97.7% of genes in this genome
Chokepoint Not a chokepoint
Catalyzed reactions

3 reactions mapped to this gene in the metabolic model. Open the full network to see each one, with substrates/products and the reaction-reaction map.

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MTTFYTVVNWLVILGYWLLIAGVTLRILMKRRAVPSAMAWLLIIYILPLVGIIAYLSFGELHLGKRRAERARAMWPSTAKWLNDLKACKHIFAEDNSPVAESLFKLCERRQGIGGVKGNQLQLLTESDDVMQALIRDIQLARHNIEMVFYIWQPGGMADSVAESLMAAARRGVHCRLMLDSAGSVAFFRSPWAAMMRNAGIEVVEALKVNLMRVFLRRMDLRQHRKMVMIDNYIAYTGSMNMVDPRYFKQDSGVGQWIDLMARMEGPVATSMGIVYSCDWEIETGKRILPPPPDVNIMPFEEASGHTIHTIASGPGFPEDLIHQALLTAAYAAKEHLIMTTPYFVPSDDLLHAICTAAQRGVDVSIILPRKNDSLLVGWASRAFFTELLAAGVKIYQFEGGLLHTKSVLVDGELSLVGTVNLDMRSLWLNFEITLVIDDAGFGSDLAAVQDDYISRSRLLDARLWLKRPLWQRIAERLFYFFSPLL

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 5 GO

Subcellular localization

Localization
CytoplasmicMembrane

Enzyme Commission (EC)

1

Gene Ontology (GO)

5
  • GO:0032049 The chemical reactions and pathways resulting in the formation of cardiolipin, 1,3-bis(3-phosphatidyl)glycerol.
  • GO:0003824 Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
  • GO:0008808 Catalysis of the reaction: phosphatidylglycerol + phosphatidylglycerol = diphosphatidylglycerol (cardiolipin) + glycerol.
  • GO:0016780 Catalysis of the transfer of a substituted phosphate group, other than diphosphate or nucleotidyl residues, from one compound (donor) to a another (acceptor).
  • GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

32 records
Show feature table
Start End DB Term Name
6 25 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
113 298 FunFam G3DSA:3.30.870.10:FF:000002 Cardiolipin synthase A
37 58 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
36 58 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
113 297 Gene3D G3DSA:3.30.870.10 Endonuclease Chain A
316 458 Gene3D G3DSA:3.30.870.10 Endonuclease Chain A
27 486 PANTHER PTHR21248 CARDIOLIPIN SYNTHASE
66 315 SUPERFAMILY SSF56024 Phospholipase D/nuclease
59 486 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
219 246 SMART SM00155 pld_4
219 246 InterPro IPR001736 Phospholipase D/Transphosphatidylase
399 426 SMART SM00155 pld_4
399 426 InterPro IPR001736 Phospholipase D/Transphosphatidylase
316 458 FunFam G3DSA:3.30.870.10:FF:000003 Cardiolipin synthase A
134 242 Pfam PF13091 PLD-like domain
134 242 InterPro IPR025202 Phospholipase D-like domain
332 444 Pfam PF13091 PLD-like domain
332 444 InterPro IPR025202 Phospholipase D-like domain
1 5 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
219 246 ProSiteProfiles PS50035 Phospholipase D phosphodiesterase active site profile.
23 59 Pfam PF13396 Phospholipase_D-nuclease N-terminal
23 59 InterPro IPR027379 Cardiolipin synthase N-terminal
26 36 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
118 281 CDD cd09152 PLDc_EcCLS_like_1
6 486 NCBIfam TIGR04265 cardiolipin synthase
6 486 InterPro IPR022924 Cardiolipin synthase
311 484 CDD cd09158 PLDc_EcCLS_like_2
10 29 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
399 426 ProSiteProfiles PS50035 Phospholipase D phosphodiesterase active site profile.
2 486 Hamap MF_00190 Cardiolipin synthase A [clsA].
2 486 InterPro IPR030840 Cardiolipin synthase A
274 473 SUPERFAMILY SSF56024 Phospholipase D/nuclease

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.718
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.484
Likely same site as FPocket 11 0.2 Å 13 shared residues 100% of smaller site
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.145
Show in viewer
Surrounding area
Pocket 4 P2Rank #4
0.06
Show in viewer
Surrounding area
Pocket 5 P2Rank #5
0.045
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #5
0.412
Show in viewer
Surrounding area
Pocket 2 FPocket #11
0.403
Likely same site as P2Rank 2 0.2 Å 13 shared residues 100% of smaller site
Show in viewer
Surrounding area
Residue sets
UniProt: Active site:224-224
UniProt: Active site:226-226
UniProt: Active site:231-231
UniProt: Active site:404-404
UniProt: Active site:406-406
UniProt: Active site:411-411
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GU90
AlphaFold DB full sequence Viewing
ColabFold VK055_0265
ColabFold full sequence Loaded

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.