KpATCC43816 Protein target profile

proofreading thioesterase in enterobactin biosynthesis

Accession: VK055_0301

Gene: AIK78927.1 ybdB 3D evidence: AlphaFold DB model + ColabFold model Metabolism 1 reaction UniProt A0A0H3GUW6
Length 136
Pocket druggability (FPocket · AlphaFold DB model) 0.273
Metabolic reactions 1
Chokepoint No
Direct ligand evidence 0 59 total records
Functional annotation 1 EC 3 GO
Target summary

Target candidate with partial support; inspect missing evidence before prioritizing.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
3.4% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
82.353 Higher values support similarity to known essential genes.
DEG E-value
6.09e-85 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
97.98 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank)
Structure A0A0H3GUW6
Pocket No pockets
Druggability (FPocket) 0.273
Structure A0A0H3GUW6
Pocket Pocket 1
ColabFold model
FPocket 0.172 · Pocket 3
Core conservation Accessory gene
Roary core
CoreCruncher accessory
Gut microbiome 162 / 4744 genomes with a hit
Prevalence 3.4%

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

Explore metabolic network

Metabolic context: no human homolog detected.

Relative network centrality 0.0% more central than 0.0% of genes in this genome
Chokepoint Not a chokepoint
Pathways

No specific KEGG pathway assigned - this reaction either has no KEGG mapping, or only matches a generic overview map with no route-level information.

Catalyzed reaction

1 reaction mapped to this gene in the metabolic model. Open the full network to see each one, with substrates/products and the reaction-reaction map.

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MIWKRQATLEQLNRLGDGNMVGLLDIRFETVTDDTLEATMPVDSRTQQPFGLLHGGASVVLAETLGSVAGYLCSEGEQKVVGLEVNANHIRSARGGRVRGVCKALHVGTRHQVWQIEIFDEQSRLCCSSRLTTAVI

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 3 GO

Subcellular localization

Localization
Unknown

Enzyme Commission (EC)

1

Gene Ontology (GO)

3
  • GO:0061522 Catalysis of the reaction 1,4-dihydroxy-2-naphthoyl-CoA + H2O = 1,4-dihydroxy-2-naphthoate + CoA + H+.
  • GO:0009234 The chemical reactions and pathways resulting in the formation of any of the menaquinones. Structurally, menaquinones consist of a methylated naphthoquinone ring structure and side chains composed of a variable number of unsaturated isoprenoid residues. Menaquinones that have vitamin K activity and are known as vitamin K2.
  • GO:0005829 The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

12 records
Show feature table
Start End DB Term Name
20 135 NCBIfam TIGR00369 hotdog fold thioesterase
20 135 InterPro IPR003736 Phenylacetic acid degradation-related domain
1 136 FunFam G3DSA:3.10.129.10:FF:000002 1,4-dihydroxy-2-naphthoyl-CoA hydrolase
18 133 PANTHER PTHR43240 1,4-DIHYDROXY-2-NAPHTHOYL-COA THIOESTERASE 1
50 127 Pfam PF03061 Thioesterase superfamily
50 127 InterPro IPR006683 Thioesterase domain
1 136 Hamap MF_01936 1,4-dihydroxy-2-naphthoyl-CoA hydrolase [menI].
1 136 InterPro IPR030863 1,4-dihydroxy-2-naphthoyl-CoA hydrolase, MenI
1 133 SUPERFAMILY SSF54637 Thioesterase/thiol ester dehydrase-isomerase
1 133 InterPro IPR029069 HotDog domain superfamily
23 135 CDD cd03443 PaaI_thioesterase
1 136 Gene3D G3DSA:3.10.129.10 Hotdog Thioesterase

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #1
0.273
Show in viewer
Surrounding area
Residue sets
UniProt: Active site:63-63 Nucleophile or proton acceptor
UniProt: Binding site:106-111
UniProt: Binding site:82-82
UniProt: Binding site:89-92
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GUW6
AlphaFold DB full sequence Viewing
ColabFold VK055_0301
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

59 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 9 records from similar proteins
Structural ligands 9 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
0FQ PDB via homolog 885.7 Da · LogP 0.02 · TPSA 363.6 Open detail RCSB PDB
31B PDB via homolog Detail RCSB PDB
4CA PDB via homolog Detail RCSB PDB
4CO PDB via homolog Detail RCSB PDB
5NE PDB via homolog Detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
0FQ RCSB PDB P0A8Y8 885.7 Da LogP 0.02 TPSA 363.6 3 viol. ✓ Clean CC(C)(CO[P@](=O)(O)O[P@@](=O)(O)OC[C@@H]1[C@H](…
31B RCSB PDB Q9I3A4 775.6 Da LogP -0.79 TPSA 337.2 3 viol. ✓ Clean CC(C)(COP(=O)(O)OP(=O)(O)OC[C@H]1[C@H]([C@H]([C…
4CA RCSB PDB Q04416 873.7 Da LogP 0.04 TPSA 366.8 3 viol. ✓ Clean CC(C)(CO[P@](=O)(O)O[P@@](=O)(O)OC[C@@H]1[C@H](…
4CO RCSB PDB Q04416 901.7 Da LogP -0.27 TPSA 383.9 3 viol. ✓ Clean CC(C)(CO[P@](=O)(O)O[P@@](=O)(O)OC[C@@H]1[C@H](…
5NE RCSB PDB B4XYA6 186.2 Da LogP 2.85 TPSA 37.3 ✓ Ro5 ✓ Clean Cc1cccc2c1cccc2C(=O)O
HFQ RCSB PDB P0A8Y8 917.7 Da LogP -0.57 TPSA 404.1 3 viol. ✓ Clean CC(C)(CO[P@](=O)(O)O[P@@](=O)(O)OC[C@@H]1[C@H](…
MLI RCSB PDB P0A8Y8 102.0 Da LogP -3.12 TPSA 80.3 ✓ Ro5 ✓ Clean C(C(=O)[O-])C(=O)[O-]
PHB RCSB PDB Q04416 138.1 Da LogP 1.09 TPSA 57.5 ✓ Ro5 ✓ Clean c1cc(ccc1C(=O)O)O
UOQ RCSB PDB P77781 935.8 Da LogP 1.85 TPSA 363.6 3 viol. ✓ Clean CCCCCCCCCC(=O)CSCCNC(=O)CCNC(=O)[C@@H](C(C)(C)C…

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.