Promising target candidate with multiple supporting evidence streams.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Evidence coverage
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- Hit
- Human identity (%)
- 51.282 Lower values reduce human off-target concern.
- Human E-value
- 1.07e-15
- Gut microbiome similarity
- 0.7% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- N
- DEG identity (%)
- 32.24 Higher values support similarity to known essential genes.
Structure confidence
- ColabFold pLDDT
- 97.35 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MKAAVTLGYQQPFVIKDVEVAPPGKDEILVKIVATGVCHTDAVMRDNPGVVPMPAILGHEGAGIVASVGEAVSGIRVGDHVVLSYAACHHCENCLSNHPSACEDFNTLNFGGRRDDGTTPYRLGDQDLSLFFGQSSFSQYVVTRASNAVVVDPDVDLTLLGPLGCGIQTGSGTVLNRLKPVVGESLVVFGCGAVGLSAIMAAKLTGCSQIIAVDIHASRLALAGELGATHQINGKEQDAVAVIKQITGKGAHYAVETTGVSAIVLQAVHAVKPLGTVAIVGFTGDITLNVQNDLMAEGKSLVGVIEGDAVPALFIPLLVQLYKQGKFPIDKLIARYPLADINQAFADSASGKVIKPVVVM
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- Cytoplasmic
Gene Ontology (GO)
5- GO:0008270 Binding to a zinc ion (Zn).
- GO:0016491 Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
- GO:0005829 The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
- GO:0051903 Catalysis of the reaction: S-(hydroxymethyl)glutathione + NAD(P)+ = S-formylglutathione + NAD(P)H + H+.
- GO:0046294 The chemical reactions and pathways resulting in the breakdown of formaldehyde (methanal, H2C=O), the simplest aldehyde.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 170 | 304 | Gene3D | G3DSA:3.40.50.720 | - |
| 58 | 72 | ProSitePatterns | PS00059 | Zinc-containing alcohol dehydrogenases signature. |
| 58 | 72 | InterPro | IPR002328 | Alcohol dehydrogenase, zinc-type, conserved site |
| 8 | 359 | SMART | SM00829 | PKS_ER_names_mod |
| 8 | 359 | InterPro | IPR020843 | Polyketide synthase, enoylreductase domain |
| 8 | 351 | Gene3D | G3DSA:3.90.180.10 | - |
| 170 | 304 | FunFam | G3DSA:3.40.50.720:FF:000003 | S-(hydroxymethyl)glutathione dehydrogenase |
| 26 | 115 | Pfam | PF08240 | Alcohol dehydrogenase GroES-like domain |
| 26 | 115 | InterPro | IPR013154 | Alcohol dehydrogenase-like, N-terminal |
| 314 | 359 | SUPERFAMILY | SSF50129 | GroES-like |
| 314 | 359 | InterPro | IPR011032 | GroES-like superfamily |
| 2 | 352 | PANTHER | PTHR43880 | ALCOHOL DEHYDROGENASE |
| 156 | 326 | SUPERFAMILY | SSF51735 | NAD(P)-binding Rossmann-fold domains |
| 156 | 326 | InterPro | IPR036291 | NAD(P)-binding domain superfamily |
| 1 | 189 | SUPERFAMILY | SSF50129 | GroES-like |
| 1 | 189 | InterPro | IPR011032 | GroES-like superfamily |
| 193 | 308 | Pfam | PF00107 | Zinc-binding dehydrogenase |
| 193 | 308 | InterPro | IPR013149 | Alcohol dehydrogenase-like, C-terminal |
| 2 | 359 | CDD | cd08278 | benzyl_alcohol_DH |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GU94
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
VK055_0533
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural and bioactivity evidence are both available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| 022 RCSB PDB | P11766 | 414.5 Da LogP 3.75 TPSA 103.1 | ✓ Ro5 | Alert |
Cc1cc(ccc1n2c(ccc2c3ccc(cc3)n4ccnc4)CCC(=O)O)C(…
|
|
| 12H RCSB PDB | P11766 | 216.3 Da LogP 2.96 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
C(CCCCCC(=O)O)CCCCCO
|
|
| AHE RCSB PDB | P11766 | 337.4 Da LogP -2.45 TPSA 179.1 | 1 viol. | ✓ Clean |
C(CC(=O)N[C@@H](CSCO)C(=O)NCC(=O)O)[C@@H](C(=O)…
|
|
| APR RCSB PDB | P11766 | 559.3 Da LogP -3.28 TPSA 291.5 | 3 viol. | ✓ Clean |
c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
|
|
| CXL RCSB PDB | P00325 | 100.2 Da LogP 1.31 TPSA 20.2 | ✓ Ro5 | ✓ Clean |
C1CCC(CC1)O
|
|
| DAO RCSB PDB | P11766 | 200.3 Da LogP 3.99 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCC(=O)O
|
|
| FXY RCSB PDB | P00326 | 157.3 Da LogP 2.09 TPSA 29.1 | ✓ Ro5 | ✓ Clean |
CCCCCC[C@@H](C)NC=O
|
|
| N2P RCSB PDB | P11766 | 102.2 Da LogP 0.07 TPSA 52.0 | ✓ Ro5 | ✓ Clean |
C(CCN)CCN
|
|
| PYZ RCSB PDB | P07327 | 194.0 Da LogP 1.01 TPSA 28.7 | ✓ Ro5 | ✓ Clean |
c1c(cn[nH]1)I
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
| Ligand | UniProt (homolog) | pchembl | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| CND ChEMBL | P07327 | 8.70 ~2.0 nM | 663.4 Da LogP -3.58 TPSA 331.4 | 3 viol. | ✓ Clean |
c1c(c[nH+]cc1C(=O)N)[C@H]2[C@@H]([C@@H]([C@H](O…
|
| CHEMBL4283157 ChEMBL | P11766 | 7.70 ~20.0 nM | 278.3 Da LogP 3.55 TPSA 55.1 | ✓ Ro5 | ✓ Clean |
Cc1cc(-n2ccnc2)ccc1-c1ccc(C(=O)O)cc1
|
| CHEMBL4290516 ChEMBL | P11766 | 7.66 ~21.9 nM | 288.3 Da LogP 2.72 TPSA 72.3 | ✓ Ro5 | ✓ Clean |
c1cn(-c2ccc(-c3ccc(-c4nn[nH]n4)cc3)cc2)cn1
|
| CHEMBL4282722 ChEMBL | P11766 | 7.54 ~28.8 nM | 282.3 Da LogP 3.38 TPSA 55.1 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(-c2ccc(-n3ccnc3)cc2)c(F)c1
|
| CHEMBL4285078 ChEMBL | P11766 | 7.54 ~28.8 nM | 278.3 Da LogP 3.55 TPSA 55.1 | ✓ Ro5 | ✓ Clean |
Cc1cc(C(=O)O)ccc1-c1ccc(-n2ccnc2)cc1
|
| CHEMBL4292916 ChEMBL | P11766 | 7.52 ~30.2 nM | 298.7 Da LogP 3.89 TPSA 55.1 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(-c2ccc(-n3ccnc3)cc2)c(Cl)c1
|
| CHEMBL4281650 ChEMBL | P11766 | 7.42 ~38.0 nM | 332.3 Da LogP 4.26 TPSA 55.1 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(-c2ccc(-n3ccnc3)cc2)c(C(F)(F)F)c1
|
| CHEMBL4290901 ChEMBL | P11766 | 7.39 ~40.7 nM | 279.3 Da LogP 2.94 TPSA 68.0 | ✓ Ro5 | ✓ Clean |
Cc1cc(-n2ccnc2)cnc1-c1ccc(C(=O)O)cc1
|
| CHEMBL4289534 ChEMBL | P11766 | 7.23 ~58.9 nM | 298.7 Da LogP 3.89 TPSA 55.1 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(-c2ccc(-n3ccnc3)cc2Cl)cc1
|
| CHEMBL4279860 ChEMBL | P11766 | 7.21 ~61.7 nM | 264.3 Da LogP 3.24 TPSA 55.1 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(-c2ccc(-n3ccnc3)cc2)cc1
|
| CHEMBL4280261 ChEMBL | P11766 | 7.05 ~89.1 nM | 299.7 Da LogP 3.29 TPSA 68.0 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(-c2ncc(-n3ccnc3)cc2Cl)cc1
|
| CHEMBL4291013 ChEMBL | P11766 | 6.67 ~213.8 nM | 265.3 Da LogP 2.63 TPSA 68.0 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(-c2ccc(-n3ccnc3)cn2)cc1
|
| BNF ChEMBL | P00325 | 6.48 ~331.1 nM | 135.2 Da LogP 0.93 TPSA 29.1 | ✓ Ro5 | ✓ Clean |
c1ccc(cc1)CNC=O
|
| HPL ChEMBL | P00325 | 6.48 ~331.1 nM | 143.2 Da LogP 1.70 TPSA 29.1 | ✓ Ro5 | ✓ Clean |
CCCCCCCNC=O
|
| CCB ChEMBL | P07327 | 6.44 ~363.1 nM | 167.3 Da LogP 1.94 TPSA 20.3 | ✓ Ro5 | ✓ Clean |
C1CCC(C1)N(C=O)C2CCC2
|
| CHEMBL1161866 ChEMBL | P07327 | 6.40 ~398.1 nM | 665.4 Da LogP -2.69 TPSA 317.6 | 3 viol. | ✓ Clean |
NC(=O)C1=CN(C2OC(COP(=O)(O)OP(=O)(O)OC[C@H]3O[C…
|
| CHEMBL48122 ChEMBL | P00326 | 6.39 ~407.4 nM | 157.3 Da LogP 2.09 TPSA 29.1 | ✓ Ro5 | ✓ Clean |
CCCCCCC(C)NC=O
|
| CHEMBL45704 ChEMBL | P07327 | 6.06 ~871.0 nM | 153.2 Da LogP 1.55 TPSA 20.3 | ✓ Ro5 | ✓ Clean |
O=CN(C1CCCC1)C1CC1
|
| CHEMBL291214 ChEMBL | P00325 | 6.00 ~1.0 µM | 141.2 Da LogP 1.31 TPSA 29.1 | ✓ Ro5 | ✓ Clean |
O=CNCC1CCCCC1
|
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC14510370 ZINC | 1.000 | 244.4 Da LogP 3.74 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
O=C(O)CCCCCCCCCCCCCO
|
| ZINC1531061 ZINC | 1.000 | 216.3 Da LogP 2.96 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
O=C(O)CCCCCCCCCCCO
|
| ZINC1610426 ZINC | 1.000 | 230.3 Da LogP 3.35 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
O=C(O)CCCCCCCCCCCCO
|
| ZINC1685531 ZINC | 1.000 | 200.4 Da LogP 2.80 TPSA 52.0 | ✓ Ro5 | ✓ Clean |
NCCCCCCCCCCCCN
|
| ZINC2168567 ZINC | 1.000 | 202.3 Da LogP 2.57 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
O=C(O)CCCCCCCCCCO
|
| ZINC34273707 ZINC | 1.000 | 256.5 Da LogP 4.37 TPSA 52.0 | ✓ Ro5 | ✓ Clean |
NCCCCCCCCCCCCCCCCN
|
| ZINC3861297 ZINC | 1.000 | 272.4 Da LogP 4.52 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
O=C(O)CCCCCCCCCCCCCCCO
|
| ZINC4284502 ZINC | 1.000 | 258.4 Da LogP 4.13 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
O=C(O)CCCCCCCCCCCCCCO
|
| ZINC5133744 ZINC | 1.000 | 226.4 Da LogP 4.82 TPSA 20.2 | ✓ Ro5 | ✓ Clean |
OC1CCCCCCCCCCCCCC1
|
| ZINC5178646 ZINC | 1.000 | 228.4 Da LogP 3.59 TPSA 52.0 | ✓ Ro5 | ✓ Clean |
NCCCCCCCCCCCCCCN
|
| ZINC5287109 ZINC | 1.000 | 286.5 Da LogP 4.91 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
O=C(O)CCCCCCCCCCCCCCCCO
|
| ZINC66156654 ZINC | 1.000 | 414.5 Da LogP 3.75 TPSA 103.1 | ✓ Ro5 | Alert |
Cc1cc(C(N)=O)ccc1-n1c(CCC(=O)O)ccc1-c1ccc(-n2cc…
|
| ZINC4002549 ZINC | 0.969 | 212.2 Da LogP 1.05 TPSA 72.3 | ✓ Ro5 | ✓ Clean |
c1cn(-c2ccc(-c3nn[nH]n3)cc2)cn1
|
| ZINC1599174 ZINC | 0.941 | 209.3 Da LogP 3.11 TPSA 20.3 | ✓ Ro5 | ✓ Clean |
O=CN(C1CCCCC1)C1CCCCC1
|
| ZINC113465827 ZINC | 0.842 | 286.4 Da LogP 3.70 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
O=C(O)CCCCC(=O)CCCCCCCCCCO
|
| ZINC4544082 ZINC | 0.814 | 335.4 Da LogP -1.38 TPSA 158.8 | ✓ Ro5 | ✓ Clean |
CCSC[C@H](NC(=O)CC[C@H](N)C(=O)O)C(=O)NCC(=O)O
|
| ZINC4544083 ZINC | 0.814 | 335.4 Da LogP -1.38 TPSA 158.8 | ✓ Ro5 | ✓ Clean |
CCSC[C@@H](NC(=O)CC[C@H](N)C(=O)O)C(=O)NCC(=O)O
|
| ZINC4544084 ZINC | 0.814 | 335.4 Da LogP -1.38 TPSA 158.8 | ✓ Ro5 | ✓ Clean |
CCSC[C@H](NC(=O)CC[C@@H](N)C(=O)O)C(=O)NCC(=O)O
|
| ZINC4544085 ZINC | 0.814 | 335.4 Da LogP -1.38 TPSA 158.8 | ✓ Ro5 | ✓ Clean |
CCSC[C@@H](NC(=O)CC[C@@H](N)C(=O)O)C(=O)NCC(=O)O
|
| ZINC2378801 ZINC | 0.800 | 200.3 Da LogP 2.78 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCC(=O)CCCCC(=O)O
|
| ZINC145953214 ZINC | 0.795 | 365.4 Da LogP -2.02 TPSA 179.0 | 1 viol. | ✓ Clean |
C[C@H](O)CSC[C@@H](NC(=O)CC[C@@H](N)C(=O)O)C(=O…
|
| ZINC145953600 ZINC | 0.795 | 365.4 Da LogP -2.02 TPSA 179.0 | 1 viol. | ✓ Clean |
C[C@H](O)CSC[C@H](NC(=O)CC[C@@H](N)C(=O)O)C(=O)…
|
| ZINC201224060 ZINC | 0.795 | 365.4 Da LogP -2.02 TPSA 179.0 | 1 viol. | ✓ Clean |
C[C@H](O)CSC[C@@H](NC(=O)CC[C@H](N)C(=O)O)C(=O)…
|
| ZINC77300920 ZINC | 0.795 | 365.4 Da LogP -2.02 TPSA 179.0 | 1 viol. | ✓ Clean |
C[C@H](O)CSC[C@H](NC(=O)CC[C@H](N)C(=O)O)C(=O)N…
|
| ZINC1532230 ZINC | 0.786 | 321.4 Da LogP -1.77 TPSA 158.8 | ✓ Ro5 | ✓ Clean |
CSC[C@H](NC(=O)CC[C@H](N)C(=O)O)C(=O)NCC(=O)O
|
| ZINC4556979 ZINC | 0.786 | 321.4 Da LogP -1.77 TPSA 158.8 | ✓ Ro5 | ✓ Clean |
CSC[C@@H](NC(=O)CC[C@H](N)C(=O)O)C(=O)NCC(=O)O
|
| ZINC4556980 ZINC | 0.786 | 321.4 Da LogP -1.77 TPSA 158.8 | ✓ Ro5 | ✓ Clean |
CSC[C@H](NC(=O)CC[C@@H](N)C(=O)O)C(=O)NCC(=O)O
|
| ZINC4556981 ZINC | 0.786 | 321.4 Da LogP -1.77 TPSA 158.8 | ✓ Ro5 | ✓ Clean |
CSC[C@@H](NC(=O)CC[C@@H](N)C(=O)O)C(=O)NCC(=O)O
|
| ZINC4962281 ZINC | 0.778 | 349.4 Da LogP -0.99 TPSA 158.8 | ✓ Ro5 | ✓ Clean |
CCCSC[C@H](NC(=O)CC[C@H](N)C(=O)O)C(=O)NCC(=O)O
|
| ZINC2113934081 ZINC | 0.762 | 270.4 Da LogP 4.73 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCC(=O)CCCCCCCCCCC(=O)O
|
| ZINC2243668 ZINC | 0.762 | 214.3 Da LogP 3.17 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCC(=O)CCCCCCC(=O)O
|
| ZINC2378799 ZINC | 0.762 | 200.3 Da LogP 2.78 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCC(=O)CCCCCC(=O)O
|
| ZINC33820423 ZINC | 0.762 | 242.4 Da LogP 3.95 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCC(=O)CCCCCCCCC(=O)O
|
| ZINC4534315 ZINC | 0.745 | 363.4 Da LogP -0.60 TPSA 158.8 | ✓ Ro5 | ✓ Clean |
CCCCSC[C@H](NC(=O)CC[C@H](N)C(=O)O)C(=O)NCC(=O)O
|
| ZINC2387442 ZINC | 0.739 | 246.4 Da LogP 4.34 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCCSCCCCC(=O)O
|
| ZINC504173140 ZINC | 0.739 | 365.4 Da LogP -2.02 TPSA 179.0 | 1 viol. | ✓ Clean |
C[C@H](CO)SC[C@H](NC(=O)CC[C@@H](N)C(=O)O)C(=O)…
|
| ZINC504173141 ZINC | 0.739 | 365.4 Da LogP -2.02 TPSA 179.0 | 1 viol. | ✓ Clean |
C[C@H](CO)SC[C@@H](NC(=O)CC[C@H](N)C(=O)O)C(=O)…
|
| ZINC504173142 ZINC | 0.739 | 365.4 Da LogP -2.02 TPSA 179.0 | 1 viol. | ✓ Clean |
C[C@H](CO)SC[C@@H](NC(=O)CC[C@@H](N)C(=O)O)C(=O…
|
| ZINC77300937 ZINC | 0.739 | 365.4 Da LogP -2.02 TPSA 179.0 | 1 viol. | ✓ Clean |
C[C@H](CO)SC[C@H](NC(=O)CC[C@H](N)C(=O)O)C(=O)N…
|
| ZINC13522300 ZINC | 0.733 | 349.4 Da LogP -1.86 TPSA 175.9 | ✓ Ro5 | ✓ Clean |
CC(=O)SC[C@H](NC(=O)CC[C@H](N)C(=O)O)C(=O)NCC(=…
|
| ZINC31350707 ZINC | 0.733 | 349.4 Da LogP -1.86 TPSA 175.9 | ✓ Ro5 | ✓ Clean |
CC(=O)SC[C@@H](NC(=O)CC[C@@H](N)C(=O)O)C(=O)NCC…
|
| ZINC31350710 ZINC | 0.733 | 349.4 Da LogP -1.86 TPSA 175.9 | ✓ Ro5 | ✓ Clean |
CC(=O)SC[C@H](NC(=O)CC[C@@H](N)C(=O)O)C(=O)NCC(…
|
| ZINC31350713 ZINC | 0.733 | 349.4 Da LogP -1.86 TPSA 175.9 | ✓ Ro5 | ✓ Clean |
CC(=O)SC[C@@H](NC(=O)CC[C@H](N)C(=O)O)C(=O)NCC(…
|
| ZINC3872731 ZINC | 0.733 | 336.3 Da LogP -1.72 TPSA 188.2 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCC(=O)N[C@@H](CSN=O)C(=O)NCC(=O)O)C(=O…
|
| ZINC3872732 ZINC | 0.733 | 336.3 Da LogP -1.72 TPSA 188.2 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCC(=O)N[C@H](CSN=O)C(=O)NCC(=O)O)C(=O)O
|
| ZINC3872733 ZINC | 0.733 | 336.3 Da LogP -1.72 TPSA 188.2 | ✓ Ro5 | ✓ Clean |
N[C@H](CCC(=O)N[C@@H](CSN=O)C(=O)NCC(=O)O)C(=O)O
|
| ZINC3872734 ZINC | 0.733 | 336.3 Da LogP -1.72 TPSA 188.2 | ✓ Ro5 | ✓ Clean |
N[C@H](CCC(=O)N[C@H](CSN=O)C(=O)NCC(=O)O)C(=O)O
|
| ZINC4795357 ZINC | 0.733 | 238.4 Da LogP 4.68 TPSA 20.2 | ✓ Ro5 | ✓ Clean |
O[C@@H]1CCCCCC2CCC(CCCC1)CC2
|
| ZINC4795359 ZINC | 0.733 | 238.4 Da LogP 4.68 TPSA 20.2 | ✓ Ro5 | ✓ Clean |
O[C@H]1CCCCCC2CCC(CCCC1)CC2
|
| ZINC14966492 ZINC | 0.717 | 423.4 Da LogP -2.47 TPSA 233.4 | 1 viol. | ✓ Clean |
N[C@H](CCC(=O)N[C@H](CS[C@@H](CC(=O)O)C(=O)O)C(…
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.