KpATCC43816 Protein target profile

nitrate reductase, beta subunit

Accession: VK055_0602

Gene: AIK79225.1 narH2 3D evidence: AlphaFold DB model + ColabFold model Metabolism 2 reactions UniProt W9BH57
Length 514
Pocket druggability (P2Rank · AlphaFold DB model) 0.157
Metabolic reactions 2
Chokepoint No
Direct ligand evidence 0 63 total records
Functional annotation 1 EC 11 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
6.0% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
89.689 Higher values support similarity to known essential genes.
DEG E-value
0.0 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
94.45 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.157
Structure W9BH57
Pocket Pocket 1
Druggability (FPocket) 0.443
Structure W9BH57
Pocket Pocket 13
ColabFold model
P2Rank 0.118 · Pocket 1
FPocket 0.407 · Pocket 1
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 283 / 4744 genomes with a hit
Prevalence 6.0%

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

Explore metabolic network

Metabolic context: no human homolog detected.

Relative network centrality 0.0% more central than 0.0% of genes in this genome
Chokepoint Not a chokepoint
Catalyzed reactions

2 reactions mapped to this gene in the metabolic model. Open the full network to see each one, with substrates/products and the reaction-reaction map.

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MKIRSQVGMVLNLDKCIGCHTCSVTCKNVWSSREGMEYAWFNNVETKPGIGYPKNWEDQDQWQGGWIRGISGKLTPRLGNRVSVLSKIFANPVLPAIDDYYEPFTYDYQHLHNAPEGKYLPTARPRSLISGERMDKINWGPNWEELLGGEFEKRARDRNFEAMQKEMYGQFENTFMMYLPRLCEHCLNPSCVATCPSGAIYKREEDGIVLIDQDKCRGWRMCISGCPYKKIYFNWKSGKSEKCIFCYPRIESGQPTVCSETCVGRIRYLGVLLYDADRIEEAASTEHETDLYERQCEVFLNPNDPAVIEEALKQGIPHNVIEAAQKSPVYKLAMDWKLALPLHPEYRTLPMVWYVPPLSPIQSVADAGGLPSNGNILPAVESLRIPVQYLANLLSAGDTGPVLRALKRMMAMRHYKRSQTVEGVTDTRAIEEVGLSVEQVEEMYRYLAIANYEDRFVIPTSHRELAEDAFPERNGCGFTFGDGCHGSDTKFNLFNSRRIDAIDVSGVRKHGEGE

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 11 GO

Subcellular localization

Localization
CytoplasmicMembrane

Enzyme Commission (EC)

1

Gene Ontology (GO)

11
  • GO:0042126 The chemical reactions and pathways involving nitrates, inorganic or organic salts and esters of nitric acid.
  • GO:0009325 An enzyme complex that catalyzes the formation of nitrate from nitrite with the concomitant reduction of an acceptor.
  • GO:0008940 Catalysis of the reaction: nitrite + acceptor = nitrate + reduced acceptor.
  • GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
  • GO:0051538 Binding to a 3 iron, 4 sulfur (3Fe-4S) cluster; this cluster consists of three iron atoms, with the inorganic sulfur atoms found between the irons and acting as bridging ligands. It is essentially a 4Fe-4S cluster with one iron missing.
  • GO:0051539 Binding to a 4 iron, 4 sulfur (4Fe-4S) cluster; this cluster consists of four iron atoms, with the inorganic sulfur atoms found between the irons and acting as bridging ligands.
  • GO:0009055 A molecular function representing the directed movement of electrons from one molecular entity to another, typically mediated by electron carriers or acceptors, resulting in the transfer of energy and/or the reduction-oxidation (redox) transformation of chemical species. This activity is fundamental to various biological processes, including cellular respiration and photosynthesis, as well as numerous enzymatic reactions involved in metabolic pathways.
  • GO:0046872 Binding to a metal ion.
  • GO:0160182 Catalysis of the reaction: a quinol + nitrate = a quinone + H2O + nitrite.
  • GO:0019645 A process in which a series of electron carriers operate together to transfer electrons from donors such as NADH and FADH2 to any of several different terminal electron acceptors other than oxygen to generate a transmembrane electrochemical gradient.
  • GO:0042128 The nitrogen metabolic process that encompasses the uptake of nitrate from the environment and reduction to ammonia, and results in the incorporation of nitrogen derived from nitrate into cellular substances.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

25 records
Show feature table
Start End DB Term Name
3 367 CDD cd10557 NarH_beta-like
3 367 InterPro IPR006547 Nitrate reductase, beta subunit
241 361 Gene3D G3DSA:3.30.70.20 -
241 362 FunFam G3DSA:3.30.70.20:FF:000008 Respiratory nitrate reductase beta subunit
175 271 Pfam PF13247 4Fe-4S dicluster domain
175 271 InterPro IPR017896 4Fe-4S ferredoxin-type, iron-sulphur binding domain
362 435 FunFam G3DSA:1.10.3650.10:FF:000001 Respiratory nitrate reductase subunit beta
7 35 ProSiteProfiles PS51379 4Fe-4S ferredoxin-type iron-sulfur binding domain profile.
7 35 InterPro IPR017896 4Fe-4S ferredoxin-type, iron-sulphur binding domain
5 73 Gene3D G3DSA:3.30.70.20 -
362 435 Gene3D G3DSA:1.10.3650.10 nitrate reductase domain like
362 435 InterPro IPR038262 Nitrate reductase beta, C-terminal domain superfamily
174 205 ProSiteProfiles PS51379 4Fe-4S ferredoxin-type iron-sulfur binding domain profile.
174 205 InterPro IPR017896 4Fe-4S ferredoxin-type, iron-sulphur binding domain
1 501 SUPERFAMILY SSF54862 4Fe-4S ferredoxins
1 506 PANTHER PTHR43518 NITRATE REDUCTASE BETA SUBUNIT
207 236 ProSiteProfiles PS51379 4Fe-4S ferredoxin-type iron-sulfur binding domain profile.
207 236 InterPro IPR017896 4Fe-4S ferredoxin-type, iron-sulphur binding domain
158 240 Gene3D G3DSA:3.30.70.20 -
157 240 FunFam G3DSA:3.30.70.20:FF:000005 Respiratory nitrate reductase beta subunit
1 493 NCBIfam TIGR01660 nitrate reductase subunit beta
1 493 InterPro IPR006547 Nitrate reductase, beta subunit
358 436 Pfam PF14711 Respiratory nitrate reductase beta C-terminal
358 436 InterPro IPR029263 Respiratory nitrate reductase beta, C-terminal
5 90 FunFam G3DSA:3.30.70.20:FF:000010 Respiratory nitrate reductase beta subunit

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.157
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.094
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.085
Show in viewer
Surrounding area
Pocket 4 P2Rank #4
0.077
Show in viewer
Surrounding area
Pocket 5 P2Rank #5
0.064
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #13
0.443
Show in viewer
Surrounding area
Pocket 2 FPocket #1
0.29 Unusual size
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_W9BH57
AlphaFold DB full sequence Viewing
ColabFold VK055_0602
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

63 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 13 records from similar proteins
Structural ligands 13 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
3PH PDB via homolog 705.0 Da · LogP 12.07 · TPSA 119.4 Open detail RCSB PDB
6MO PDB via homolog Detail RCSB PDB
AGA PDB via homolog Detail RCSB PDB
BSY PDB via homolog Detail RCSB PDB
CDL PDB via homolog Detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
3PH RCSB PDB P11349 705.0 Da LogP 12.07 TPSA 119.4 2 viol. ✓ Clean CCCCCCCCCCCCCCCCCC(=O)OC[C@H](COP(=O)(O)O)OC(=O…
6MO RCSB PDB P11349 95.9 Da LogP -0.00 TPSA 0.0 ✓ Ro5 ✓ Clean [Mo+6]
AGA RCSB PDB P11349 455.5 Da LogP 1.85 TPSA 151.7 ✓ Ro5 ✓ Clean CCCCCCCC(=O)O[C@H](COC(=O)CCCC)COP(=O)([O-])OC[…
BSY RCSB PDB G8QM54 128.0 Da LogP -2.25 TPSA 60.4 ✓ Ro5 ✓ Clean O[Se](=O)[O-]
CDL RCSB PDB P0AAJ3 1464.1 Da LogP 23.31 TPSA 242.6 3 viol. ✓ Clean CCCCCCCCCCCCCCCCCC(=O)OC[C@H](COP(=O)([O-])OCC(…
F3S RCSB PDB Q1PZD5 295.8 Da LogP 2.59 TPSA 0.0 ✓ Ro5 ✓ Clean S1[Fe]2S[Fe]3[S]2[Fe]1S3
HQO RCSB PDB P0AAJ3 259.3 Da LogP 3.69 TPSA 47.2 ✓ Ro5 Alert CCCCCCCc1cc(c2ccccc2[n+]1[O-])O
MD1 RCSB PDB Q1PZD5 740.6 Da LogP -2.13 TPSA 358.0 3 viol. ✓ Clean c1nc2c(n1[C@H]3[C@@H]([C@@H]([C@H](O3)CO[P@](=O…
MGD RCSB PDB Q7WTT9 740.6 Da LogP -2.06 TPSA 346.6 3 viol. ✓ Clean c1nc2c(n1[C@H]3[C@@H]([C@@H]([C@H](O3)CO[P@@](=…
MO RCSB PDB Q7WTT9 95.9 Da LogP -0.00 TPSA 0.0 ✓ Ro5 ✓ Clean [Mo]
O RCSB PDB Q7WTT9 18.0 Da LogP -0.82 TPSA 31.5 ✓ Ro5 ✓ Clean O
PCI RCSB PDB P11349 266.3 Da LogP 4.66 TPSA 20.2 ✓ Ro5 ✓ Clean c1(c(c(c(c(c1Cl)Cl)Cl)Cl)Cl)O
PG5 RCSB PDB Q7WTT9 178.2 Da LogP 0.31 TPSA 36.9 ✓ Ro5 ✓ Clean COCCOCCOCCOC

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.