KpATCC43816 Protein target profile

formate dehydrogenase, beta subunit

Accession: VK055_0618

Gene: AIK79241.1 fdxH2 3D evidence: AlphaFold DB model + ColabFold model Metabolism 1 reaction UniProt A0A0H3GQB9
Length 294
Pocket druggability (P2Rank · AlphaFold DB model) 0.107
Metabolic reactions 1
Chokepoint No
Direct ligand evidence 0 64 total records
Functional annotation 0 EC 9 GO
Target summary

Target candidate with partial support; inspect missing evidence before prioritizing.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
3.2% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
35.632 Higher values support similarity to known essential genes.

Structure confidence

ColabFold pLDDT
96.19 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.107
Structure A0A0H3GQB9
Pocket Pocket 1
Druggability (FPocket) 0.478
Structure A0A0H3GQB9
Pocket Pocket 1
ColabFold model
P2Rank 0.128 · Pocket 1
FPocket 0.503 · Pocket 1
Core conservation Accessory gene
Roary core
CoreCruncher accessory
Gut microbiome 151 / 4744 genomes with a hit
Prevalence 3.2%

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

Explore metabolic network

Metabolic context: no human homolog detected.

Relative network centrality 0.0% more central than 0.0% of genes in this genome
Chokepoint Not a chokepoint
Catalyzed reaction

1 reaction mapped to this gene in the metabolic model. Open the full network to see each one, with substrates/products and the reaction-reaction map.

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MAMETQDIIKRSATNPITPAPRARDYKAEVAKLIDVSSCVGCKACQVACSEWNDIRDDVGHCVGVYDNPADLSAKSWTVMRFSETEQNGKLEWLIRKDGCMHCAEPGCLKACPSAGAIIQYANGIVDFQQENCIGCGYCIAGCPFNVPRLNKEDNRVYKCTLCVDRVSVGQEPACVKTCPTGAIHFGTKKEMLEVAEERVAKLKKRGYANAGIYNPPGVGGTHVMYVLHHADQPELYHKLPKEPQIDTSISLWKGALKPLAAAGFIATFAGLIYHYIGIGPNKEVDDDEEKHDE

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

9 GO

Subcellular localization

Localization
CytoplasmicMembrane

Gene Ontology (GO)

9
  • GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
  • GO:0015944 The chemical reactions and pathways by which formate is converted to CO2.
  • GO:0051539 Binding to a 4 iron, 4 sulfur (4Fe-4S) cluster; this cluster consists of four iron atoms, with the inorganic sulfur atoms found between the irons and acting as bridging ligands.
  • GO:0045333 The enzymatic release of energy from inorganic and organic compounds (especially carbohydrates and fats) which either requires oxygen (aerobic respiration) or does not (anaerobic respiration).
  • GO:0009326 An enzyme complex that catalyzes the dehydrogenation of formate to produce carbon dioxide (CO2).
  • GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
  • GO:0036397 Catalysis of the reaction: formate + a quinone = CO2 + a quinol.
  • GO:0046872 Binding to a metal ion.
  • GO:0009061 The enzymatic release of energy from inorganic and organic compounds (especially carbohydrates and fats) which uses compounds other than oxygen (e.g. nitrate, sulfate) as the terminal electron acceptor.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

30 records
Show feature table
Start End DB Term Name
124 153 ProSiteProfiles PS51379 4Fe-4S ferredoxin-type iron-sulfur binding domain profile.
124 153 InterPro IPR017896 4Fe-4S ferredoxin-type, iron-sulphur binding domain
248 294 FunFam G3DSA:1.20.5.480:FF:000001 Formate dehydrogenase iron-sulfur subunit
91 123 ProSiteProfiles PS51379 4Fe-4S ferredoxin-type iron-sulfur binding domain profile.
91 123 InterPro IPR017896 4Fe-4S ferredoxin-type, iron-sulphur binding domain
38 50 Pfam PF12800 4Fe-4S binding domain
38 50 InterPro IPR017896 4Fe-4S ferredoxin-type, iron-sulphur binding domain
7 166 Gene3D G3DSA:3.30.70.20 -
2 291 PANTHER PTHR43545 FORMATE DEHYDROGENASE, NITRATE-INDUCIBLE, IRON-SULFUR SUBUNIT
246 289 Pfam PF09163 Formate dehydrogenase N, transmembrane
246 289 InterPro IPR015246 Formate dehydrogenase, transmembrane
133 144 ProSitePatterns PS00198 4Fe-4S ferredoxin-type iron-sulfur binding region signature.
133 144 InterPro IPR017900 4Fe-4S ferredoxin, iron-sulphur binding, conserved site
260 277 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
92 188 Pfam PF13247 4Fe-4S dicluster domain
92 188 InterPro IPR017896 4Fe-4S ferredoxin-type, iron-sulphur binding domain
247 294 Gene3D G3DSA:1.20.5.480 Single helix bin
247 294 InterPro IPR038384 Formate dehydrogenase, C-terminal domain superfamily
7 290 NCBIfam TIGR01582 formate dehydrogenase subunit beta
7 290 InterPro IPR006470 Formate dehydrogenase iron-sulphur subunit, Proteobacteria
26 262 SUPERFAMILY SSF54862 4Fe-4S ferredoxins
278 294 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
1 259 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
30 60 ProSiteProfiles PS51379 4Fe-4S ferredoxin-type iron-sulfur binding domain profile.
30 60 InterPro IPR017896 4Fe-4S ferredoxin-type, iron-sulphur binding domain
1 294 PIRSF PIRSF036298 FDH_4Fe4S
1 294 InterPro IPR014603 Formate dehydrogenase iron-sulphur subunit
32 228 Gene3D G3DSA:3.30.70.20 -
31 238 CDD cd10558 FDH-N
31 238 InterPro IPR006470 Formate dehydrogenase iron-sulphur subunit, Proteobacteria

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.107
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.076
Likely same site as FPocket 1 0.6 Å 8 shared residues 100% of smaller site
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.052
Show in viewer
Surrounding area
Pocket 4 P2Rank #4
0.043
Show in viewer
Surrounding area
Pocket 5 P2Rank #5
0.036
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #1
0.478
Likely same site as P2Rank 2 0.6 Å 8 shared residues 100% of smaller site
Show in viewer
Surrounding area
Residue sets
UniProt: Binding site:100-100
UniProt: Binding site:103-103
UniProt: Binding site:108-108
UniProt: Binding site:112-112
UniProt: Binding site:133-133
UniProt: Binding site:136-136
UniProt: Binding site:139-139
UniProt: Binding site:143-143
UniProt: Binding site:160-160
UniProt: Binding site:163-163
UniProt: Binding site:175-175
UniProt: Binding site:179-179
UniProt: Binding site:39-39
UniProt: Binding site:42-42
UniProt: Binding site:45-45
UniProt: Binding site:49-49
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GQB9
AlphaFold DB full sequence Viewing
ColabFold VK055_0618
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

64 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 14 records from similar proteins
Structural ligands 14 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
2MD PDB via homolog 742.6 Da · LogP -2.53 · TPSA 346.6 Open detail RCSB PDB
3PH PDB via homolog Detail RCSB PDB
6MO PDB via homolog Detail RCSB PDB
AGA PDB via homolog Detail RCSB PDB
BSY PDB via homolog Detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
2MD RCSB PDB Q8GC87 742.6 Da LogP -2.53 TPSA 346.6 3 viol. ✓ Clean c1nc2c(n1[C@H]3[C@@H]([C@@H]([C@H](O3)CO[P@@](=…
3PH RCSB PDB P11349 705.0 Da LogP 12.07 TPSA 119.4 2 viol. ✓ Clean CCCCCCCCCCCCCCCCCC(=O)OC[C@H](COP(=O)(O)O)OC(=O…
6MO RCSB PDB P0AAJ3 95.9 Da LogP -0.00 TPSA 0.0 ✓ Ro5 ✓ Clean [Mo+6]
AGA RCSB PDB P11349 455.5 Da LogP 1.85 TPSA 151.7 ✓ Ro5 ✓ Clean CCCCCCCC(=O)O[C@H](COC(=O)CCCC)COP(=O)([O-])OC[…
BSY RCSB PDB G8QM54 128.0 Da LogP -2.25 TPSA 60.4 ✓ Ro5 ✓ Clean O[Se](=O)[O-]
CDL RCSB PDB P0AAJ3 1464.1 Da LogP 23.31 TPSA 242.6 3 viol. ✓ Clean CCCCCCCCCCCCCCCCCC(=O)OC[C@H](COP(=O)([O-])OCC(…
F3S RCSB PDB D0MDD5 295.8 Da LogP 2.59 TPSA 0.0 ✓ Ro5 ✓ Clean S1[Fe]2S[Fe]3[S]2[Fe]1S3
H2S RCSB PDB Q72EJ0 34.1 Da LogP 0.11 TPSA 0.0 ✓ Ro5 ✓ Clean S
HQO RCSB PDB P0AAJ3 259.3 Da LogP 3.69 TPSA 47.2 ✓ Ro5 Alert CCCCCCCc1cc(c2ccccc2[n+]1[O-])O
MD1 RCSB PDB P11349 740.6 Da LogP -2.13 TPSA 358.0 3 viol. ✓ Clean c1nc2c(n1[C@H]3[C@@H]([C@@H]([C@H](O3)CO[P@](=O…
MGD RCSB PDB P0AAJ3 740.6 Da LogP -2.06 TPSA 346.6 3 viol. ✓ Clean c1nc2c(n1[C@H]3[C@@H]([C@@H]([C@H](O3)CO[P@@](=…
MO RCSB PDB P11349 95.9 Da LogP -0.00 TPSA 0.0 ✓ Ro5 ✓ Clean [Mo]
PCI RCSB PDB P11349 266.3 Da LogP 4.66 TPSA 20.2 ✓ Ro5 ✓ Clean c1(c(c(c(c(c1Cl)Cl)Cl)Cl)Cl)O
W RCSB PDB Q72EJ0 183.8 Da LogP -0.00 TPSA 0.0 ✓ Ro5 ✓ Clean [W+6]

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.