Promising target candidate with multiple supporting evidence streams.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Evidence coverage
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- Hit
- Human identity (%)
- 30.328 Lower values reduce human off-target concern.
- Human E-value
- 1.33e-11
- Gut microbiome similarity
- 1.0% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- Y
- DEG identity (%)
- 73.632 Higher values support similarity to known essential genes.
- DEG E-value
- 2.28e-100 Smaller values mean stronger essential-gene similarity.
Structure confidence
- ColabFold pLDDT
- 97.59 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
ColabFold / curated modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MVSSTIASADAQAIAEALAEYQLLMLDAPVSGGAVKAAAGDMTVMASGSDAAFARLAPVLDAVAGKVYRIGSDIGLGSTVKIIHQLLAGVHIAVAAEAMALAARAGIPLETMYDVVTHAAGNSWMFENRMQHVLDGDYSPKSAVDIFVKDLGLVNDTARALTFPLPLATTALNMFTSASNAGFGREDDSAVIKIFNGITLPGYKQ
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- Cytoplasmic
Gene Ontology (GO)
3- GO:0050661 Binding to nicotinamide-adenine dinucleotide phosphate, a coenzyme involved in many redox and biosynthetic reactions; binding may be to either the oxidized form, NADP+, or the reduced form, NADPH.
- GO:0051287 Binding to nicotinamide adenine dinucleotide, a coenzyme involved in many redox and biosynthetic reactions; binding may be to either the oxidized form, NAD+, or the reduced form, NADH.
- GO:0016491 Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 4 | 72 | SUPERFAMILY | SSF51735 | NAD(P)-binding Rossmann-fold domains |
| 4 | 72 | InterPro | IPR036291 | NAD(P)-binding domain superfamily |
| 73 | 197 | SUPERFAMILY | SSF48179 | 6-phosphogluconate dehydrogenase C-terminal domain-like |
| 73 | 197 | InterPro | IPR008927 | 6-phosphogluconate dehydrogenase-like, C-terminal domain superfamily |
| 3 | 198 | PANTHER | PTHR43060 | 3-HYDROXYISOBUTYRATE DEHYDROGENASE-LIKE 1, MITOCHONDRIAL-RELATED |
| 75 | 194 | Pfam | PF14833 | NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase |
| 75 | 194 | InterPro | IPR029154 | 3-hydroxyisobutyrate dehydrogenase-like, NAD-binding domain |
| 1 | 72 | Gene3D | G3DSA:3.40.50.720 | - |
| 75 | 198 | Gene3D | G3DSA:1.10.1040.10 | - |
| 75 | 198 | InterPro | IPR013328 | 6-phosphogluconate dehydrogenase, domain 2 |
| 3 | 69 | Pfam | PF03446 | NAD binding domain of 6-phosphogluconate dehydrogenase |
| 3 | 69 | InterPro | IPR006115 | 6-phosphogluconate dehydrogenase, NADP-binding |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
All structural evidence
Structural evidence
0 + 1Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
ColabFold
VK055_0893
|
ColabFold | — | — | full sequence | — | Viewing |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural ligand evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| 3OH RCSB PDB | P9WNY5 | 90.1 Da LogP -0.55 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
C(CO)C(=O)O
|
|
| 9ON RCSB PDB | P9WNY5 | 146.1 Da LogP 0.57 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
C[C@@H](CCC(=O)O)C(=O)O
|
|
| AKR RCSB PDB | P9WNY5 | 72.1 Da LogP 0.26 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
C=CC(=O)O
|
|
| BO3 RCSB PDB | P0A9V8 | 61.8 Da LogP -2.05 TPSA 60.7 | ✓ Ro5 | ✓ Clean |
B(O)(O)O
|
|
| HIU RCSB PDB | P9WNY5 | 104.1 Da LogP -0.30 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
C[C@H](CO)C(=O)O
|
|
| HUI RCSB PDB | P9WNY5 | 104.1 Da LogP -0.30 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
C[C@@H](CO)C(=O)O
|
|
| LLQ RCSB PDB | P0A9V8 | 156.2 Da LogP -1.77 TPSA 94.8 | ✓ Ro5 | ✓ Clean |
C([C@@H](CS(=O)(=O)O)O)O
|
|
| TLA RCSB PDB | A3MU08 | 150.1 Da LogP -2.12 TPSA 115.1 | ✓ Ro5 | ✓ Clean |
[C@@H]([C@H](C(=O)O)O)(C(=O)O)O
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC12359024 ZINC | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@@H](O)[C@H](O)[C@H](O)[C@@H](O)C(=O)O
|
| ZINC13533920 ZINC | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@@H](O)[C@H](O)[C@@H](O)[C@@H](O)C(=O)O
|
| ZINC1532740 ZINC | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@@H](O)[C@H](O)[C@@H](O)[C@H](O)C(=O)O
|
| ZINC1549593 ZINC | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@H](O)[C@H](O)[C@@H](O)[C@@H](O)C(=O)O
|
| ZINC2013424 ZINC | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@@H](O)[C@@H](O)[C@@H](O)[C@H](O)C(=O)O
|
| ZINC3581021 ZINC | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@H](O)[C@@H](O)[C@@H](O)[C@@H](O)C(=O)O
|
| ZINC3860635 ZINC | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)C(=O)O
|
| ZINC5783661 ZINC | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C(=O)O
|
| ZINC6072527 ZINC | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@@H](O)[C@@H](O)[C@@H](O)[C@@H](O)C(=O)O
|
| ZINC2029340 ZINC | 0.591 | 216.3 Da LogP 2.38 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
C[C@@H](CCCCC[C@@H](C)C(=O)O)C(=O)O
|
| ZINC2029341 ZINC | 0.591 | 216.3 Da LogP 2.38 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
C[C@H](CCCCC[C@@H](C)C(=O)O)C(=O)O
|
| ZINC2029343 ZINC | 0.591 | 216.3 Da LogP 2.38 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
C[C@@H](CCCCC[C@H](C)C(=O)O)C(=O)O
|
| ZINC2029346 ZINC | 0.591 | 230.3 Da LogP 2.77 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
C[C@@H](CCCCCC[C@@H](C)C(=O)O)C(=O)O
|
| ZINC2029348 ZINC | 0.591 | 230.3 Da LogP 2.77 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
C[C@H](CCCCCC[C@@H](C)C(=O)O)C(=O)O
|
| ZINC2029350 ZINC | 0.591 | 230.3 Da LogP 2.77 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
C[C@@H](CCCCCC[C@H](C)C(=O)O)C(=O)O
|
| ZINC2029355 ZINC | 0.591 | 258.4 Da LogP 3.55 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
C[C@@H](CCCCCCCC[C@@H](C)C(=O)O)C(=O)O
|
| ZINC2029358 ZINC | 0.591 | 258.4 Da LogP 3.55 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
C[C@H](CCCCCCCC[C@@H](C)C(=O)O)C(=O)O
|
| ZINC2029360 ZINC | 0.591 | 258.4 Da LogP 3.55 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
C[C@@H](CCCCCCCC[C@H](C)C(=O)O)C(=O)O
|
| ZINC4100991 ZINC | 0.591 | 286.4 Da LogP 4.33 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
C[C@@H](CCCCCCCCCC[C@@H](C)C(=O)O)C(=O)O
|
| ZINC4100995 ZINC | 0.591 | 286.4 Da LogP 4.33 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
C[C@H](CCCCCCCCCC[C@@H](C)C(=O)O)C(=O)O
|
| ZINC4101001 ZINC | 0.591 | 286.4 Da LogP 4.33 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
C[C@@H](CCCCCCCCCC[C@H](C)C(=O)O)C(=O)O
|
| ZINC1560405156 ZINC | 0.588 | 208.1 Da LogP -1.79 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)/C(O)=C(\O)[C@H](O)[C@H](O)C(=O)O
|
| ZINC1560405157 ZINC | 0.588 | 208.1 Da LogP -1.79 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)/C(O)=C(/O)[C@H](O)[C@H](O)C(=O)O
|
| ZINC142127993 ZINC | 0.571 | 219.2 Da LogP -1.20 TPSA 123.9 | ✓ Ro5 | ✓ Clean |
C[C@H](O)C(=O)N[C@@H](CCC(=O)O)C(=O)O
|
| ZINC214811896 ZINC | 0.571 | 219.2 Da LogP -1.20 TPSA 123.9 | ✓ Ro5 | ✓ Clean |
C[C@@H](O)C(=O)N[C@@H](CCC(=O)O)C(=O)O
|
| ZINC214811946 ZINC | 0.571 | 219.2 Da LogP -1.20 TPSA 123.9 | ✓ Ro5 | ✓ Clean |
C[C@H](O)C(=O)N[C@H](CCC(=O)O)C(=O)O
|
| ZINC214811999 ZINC | 0.571 | 219.2 Da LogP -1.20 TPSA 123.9 | ✓ Ro5 | ✓ Clean |
C[C@@H](O)C(=O)N[C@H](CCC(=O)O)C(=O)O
|
| ZINC13529664 ZINC | 0.560 | 320.3 Da LogP -1.08 TPSA 190.3 | 1 viol. | ✓ Clean |
O=C(O)CC[C@H](NC(=O)N[C@@H](CCC(=O)O)C(=O)O)C(=…
|
| ZINC14510370 ZINC | 0.556 | 244.4 Da LogP 3.74 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
O=C(O)CCCCCCCCCCCCCO
|
| ZINC1531061 ZINC | 0.556 | 216.3 Da LogP 2.96 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
O=C(O)CCCCCCCCCCCO
|
| ZINC1610426 ZINC | 0.556 | 230.3 Da LogP 3.35 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
O=C(O)CCCCCCCCCCCCO
|
| ZINC2168567 ZINC | 0.556 | 202.3 Da LogP 2.57 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
O=C(O)CCCCCCCCCCO
|
| ZINC3861297 ZINC | 0.556 | 272.4 Da LogP 4.52 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
O=C(O)CCCCCCCCCCCCCCCO
|
| ZINC4284502 ZINC | 0.556 | 258.4 Da LogP 4.13 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
O=C(O)CCCCCCCCCCCCCCO
|
| ZINC5287109 ZINC | 0.556 | 286.5 Da LogP 4.91 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
O=C(O)CCCCCCCCCCCCCCCCO
|
| ZINC2242980 ZINC | 0.552 | 218.2 Da LogP -1.23 TPSA 129.7 | ✓ Ro5 | ✓ Clean |
C[C@H](N)C(=O)N[C@@H](CCC(=O)O)C(=O)O
|
| ZINC2560662 ZINC | 0.552 | 218.2 Da LogP -1.23 TPSA 129.7 | ✓ Ro5 | ✓ Clean |
C[C@@H](N)C(=O)N[C@H](CCC(=O)O)C(=O)O
|
| ZINC5360219 ZINC | 0.552 | 231.2 Da LogP 0.47 TPSA 103.7 | ✓ Ro5 | ✓ Clean |
CC(C)CC(=O)N[C@@H](CCC(=O)O)C(=O)O
|
| ZINC3845741 ZINC | 0.542 | 202.2 Da LogP 1.84 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
CC(C)[C@@H](CC[C@@H](C)C(=O)O)C(=O)O
|
| ZINC3845742 ZINC | 0.542 | 202.2 Da LogP 1.84 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
CC(C)[C@H](CC[C@@H](C)C(=O)O)C(=O)O
|
| ZINC3845743 ZINC | 0.542 | 202.2 Da LogP 1.84 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
CC(C)[C@@H](CC[C@H](C)C(=O)O)C(=O)O
|
| ZINC3845744 ZINC | 0.542 | 202.2 Da LogP 1.84 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
CC(C)[C@H](CC[C@H](C)C(=O)O)C(=O)O
|
| ZINC217513646 ZINC | 0.538 | 362.3 Da LogP -1.76 TPSA 207.4 | 1 viol. | ✓ Clean |
O=C(O)CC[C@H](NC(=O)CC(=O)N[C@@H](CCC(=O)O)C(=O…
|
| ZINC225956904 ZINC | 0.538 | 362.3 Da LogP -1.76 TPSA 207.4 | 1 viol. | ✓ Clean |
O=C(O)CC[C@H](NC(=O)CC(=O)N[C@H](CCC(=O)O)C(=O)…
|
| ZINC225956918 ZINC | 0.538 | 362.3 Da LogP -1.76 TPSA 207.4 | 1 viol. | ✓ Clean |
O=C(O)CC[C@@H](NC(=O)CC(=O)N[C@H](CCC(=O)O)C(=O…
|
| ZINC58123315 ZINC | 0.538 | 376.3 Da LogP -1.36 TPSA 207.4 | 1 viol. | ✓ Clean |
O=C(O)CC[C@H](NC(=O)CCC(=O)N[C@@H](CCC(=O)O)C(=…
|
| ZINC58123320 ZINC | 0.538 | 376.3 Da LogP -1.36 TPSA 207.4 | 1 viol. | ✓ Clean |
O=C(O)CC[C@H](NC(=O)CCC(=O)N[C@H](CCC(=O)O)C(=O…
|
| ZINC58123326 ZINC | 0.538 | 376.3 Da LogP -1.36 TPSA 207.4 | 1 viol. | ✓ Clean |
O=C(O)CC[C@@H](NC(=O)CCC(=O)N[C@H](CCC(=O)O)C(=…
|
| ZINC87491353 ZINC | 0.536 | 259.3 Da LogP -3.16 TPSA 138.5 | ✓ Ro5 | ✓ Clean |
O=S(=O)(O)C[C@@H](O)CN(CO)C(CO)CO
|
| ZINC87491354 ZINC | 0.536 | 259.3 Da LogP -3.16 TPSA 138.5 | ✓ Ro5 | ✓ Clean |
O=S(=O)(O)C[C@H](O)CN(CO)C(CO)CO
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.