KpATCC43816 Protein target profile
methylated-DNA-[]-cysteine S-methyltransferase family protein
Accession: VK055_0973
Target candidate with partial support; inspect missing evidence before prioritizing.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Evidence coverage
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- Hit
- Human identity (%)
- 52.381 Lower values reduce human off-target concern.
- Human E-value
- 1.3100000000000003e-21
- Gut microbiome similarity
- 1.7% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- Y
- DEG identity (%)
- 51.456 Higher values support similarity to known essential genes.
- DEG E-value
- 3.58e-32 Smaller values mean stronger essential-gene similarity.
Structure confidence
- ColabFold pLDDT
- 95.65 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MLTLLQDKMDTPLGPLWVLCDEQFNLRAVEWDEHRDRMETLLDVHYRREGYQRVDCRNPGGLSSKLSDYFAGDLAIIETLPTATAGTSFQRQVWQALREIPCGQVMHYGQLAEALGRPGAARAVGAANGANPVSIVVPCHRVIGRNGTMTGYAGGVQRKEWLLRHEGYLLL
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- Cytoplasmic
Enzyme Commission (EC)
1Gene Ontology (GO)
6- GO:0003908 Catalysis of the reaction: DNA (containing 6-O-methylguanine) + (protein)-L-cysteine = DNA (without 6-O-methylguanine) + protein S-methyl-L-cysteine.
- GO:0003824 Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
- GO:0006281 The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
- GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
- GO:0006307 The repair of alkylation damage in DNA, e.g. the removal of a non-physiological alkyl group from a nucleobase. This is usually mediated by DNA alkyltransferases.
- GO:0032259 The process in which a methyl group is covalently attached to a molecule.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 7 | 92 | SUPERFAMILY | SSF53155 | Methylated DNA-protein cysteine methyltransferase domain |
| 7 | 92 | InterPro | IPR036631 | Methylated DNA-protein cysteine methyltransferase domain superfamily |
| 89 | 167 | CDD | cd06445 | ATase |
| 89 | 167 | InterPro | IPR014048 | Methylated-DNA-[protein]-cysteine S-methyltransferase, DNA binding |
| 81 | 168 | Gene3D | G3DSA:1.10.10.10 | - |
| 81 | 168 | InterPro | IPR036388 | Winged helix-like DNA-binding domain superfamily |
| 88 | 167 | Pfam | PF01035 | 6-O-methylguanine DNA methyltransferase, DNA binding domain |
| 88 | 167 | InterPro | IPR014048 | Methylated-DNA-[protein]-cysteine S-methyltransferase, DNA binding |
| 87 | 166 | NCBIfam | TIGR00589 | methylated-DNA--[protein]-cysteine S-methyltransferase |
| 87 | 166 | InterPro | IPR014048 | Methylated-DNA-[protein]-cysteine S-methyltransferase, DNA binding |
| 86 | 169 | SUPERFAMILY | SSF46767 | Methylated DNA-protein cysteine methyltransferase, C-terminal domain |
| 86 | 169 | InterPro | IPR036217 | Methylated DNA-protein cysteine methyltransferase, DNA binding domain |
| 8 | 167 | Hamap | MF_00772 | Methylated-DNA--protein-cysteine methyltransferase [ogt]. |
| 8 | 167 | InterPro | IPR023546 | Methylated-DNA--protein-cysteine methyltransferase |
| 4 | 168 | PANTHER | PTHR10815 | METHYLATED-DNA--PROTEIN-CYSTEINE METHYLTRANSFERASE |
| 137 | 143 | ProSitePatterns | PS00374 | Methylated-DNA--protein-cysteine methyltransferase active site. |
| 137 | 143 | InterPro | IPR001497 | Methylated-DNA-[protein]-cysteine S-methyltransferase, active site |
| 85 | 168 | FunFam | G3DSA:1.10.10.10:FF:000337 | Methylated-DNA--protein-cysteine methyltransferase |
| 4 | 83 | Pfam | PF02870 | 6-O-methylguanine DNA methyltransferase, ribonuclease-like domain |
| 4 | 83 | InterPro | IPR008332 | Methylguanine DNA methyltransferase, ribonuclease-like domain |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Residue sets
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Residue sets
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GSX7
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
VK055_0973
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural ligand evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| ETW RCSB PDB | Q97VW7 | 479.5 Da LogP 5.21 TPSA 116.8 | 1 viol. | ✓ Clean |
Cc1ccc(cc1)CNC(=O)c2ccc(c(c2)C(=O)O)C3=C4C=CC(=…
|
|
| OGQ RCSB PDB | E5BBQ0 | 534.6 Da LogP 5.24 TPSA 85.8 | 2 viol. | ✓ Clean |
Cc1ccc(cc1)CNC(=O)c2ccc(c(c2)C3=C4C=CC(=[N+](C)…
|
|
| PBO RCSB PDB | Q9UTN9 | 149.2 Da LogP 2.06 TPSA 30.0 | ✓ Ro5 | ✓ Clean |
CCCC(=O)c1cccnc1
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC100071118 ZINC | 0.758 | 205.3 Da LogP 3.62 TPSA 30.0 | ✓ Ro5 | ✓ Clean |
CCCCCCCC(=O)c1cccnc1
|
| ZINC100071122 ZINC | 0.758 | 219.3 Da LogP 4.01 TPSA 30.0 | ✓ Ro5 | ✓ Clean |
CCCCCCCCC(=O)c1cccnc1
|
| ZINC22054134 ZINC | 0.723 | 431.5 Da LogP 3.70 TPSA 94.0 | ✓ Ro5 | ✓ Clean |
CN(C)c1ccc2c(-c3cc(C(=O)O)ccc3C(=O)O)c3ccc(=[N+…
|
| ZINC5030658 ZINC | 0.683 | 376.3 Da LogP 3.67 TPSA 125.0 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(-c2c3ccc(=O)cc-3oc3cc(O)ccc23)c(C(=…
|
| ZINC28630842 ZINC | 0.681 | 489.5 Da LogP 4.34 TPSA 154.1 | ✓ Ro5 | ✓ Clean |
O=C(O)CCCCCNC(=O)c1ccc(-c2c3ccc(=O)cc-3oc3cc(O)…
|
| ZINC100083979 ZINC | 0.667 | 226.2 Da LogP 1.93 TPSA 59.9 | ✓ Ro5 | ✓ Clean |
O=C(CC(=O)c1cccnc1)c1cccnc1
|
| ZINC2379080 ZINC | 0.667 | 207.2 Da LogP 1.61 TPSA 56.3 | ✓ Ro5 | ✓ Clean |
CCOC(=O)CCC(=O)c1cccnc1
|
| ZINC70915012 ZINC | 0.647 | 203.2 Da LogP 2.61 TPSA 30.0 | ✓ Ro5 | ✓ Clean |
O=C(CCC(F)(F)F)c1cccnc1
|
| ZINC2379083 ZINC | 0.632 | 221.3 Da LogP 2.00 TPSA 56.3 | ✓ Ro5 | ✓ Clean |
CCOC(=O)CCCC(=O)c1cccnc1
|
| ZINC34274984 ZINC | 0.629 | 211.3 Da LogP 2.90 TPSA 30.0 | ✓ Ro5 | ✓ Clean |
O=C(CCc1ccccc1)c1cccnc1
|
| ZINC100077468 ZINC | 0.625 | 225.2 Da LogP 2.54 TPSA 47.0 | ✓ Ro5 | ✓ Clean |
O=C(CC(=O)c1cccnc1)c1ccccc1
|
| ZINC169722656 ZINC | 0.622 | 458.4 Da LogP 4.40 TPSA 165.6 | ✓ Ro5 | Alert |
[N-]=[N+]=NCCCNC(=O)c1ccc(C(=O)O)c(-c2c3ccc(=O)…
|
| ZINC161862 ZINC | 0.611 | 211.3 Da LogP 2.82 TPSA 30.0 | ✓ Ro5 | ✓ Clean |
Cc1ccc(CC(=O)c2cccnc2)cc1
|
| ZINC37992322 ZINC | 0.611 | 211.3 Da LogP 2.82 TPSA 30.0 | ✓ Ro5 | ✓ Clean |
Cc1ccccc1CC(=O)c1cccnc1
|
| ZINC5248684 ZINC | 0.594 | 376.3 Da LogP 3.67 TPSA 125.0 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(C(=O)O)c(-c2c3ccc(=O)cc-3oc3cc(O)cc…
|
| ZINC6562820 ZINC | 0.590 | 220.3 Da LogP 1.52 TPSA 50.3 | ✓ Ro5 | ✓ Clean |
CC(=O)N(C)CCCC(=O)c1cccnc1
|
| ZINC3872582 ZINC | 0.587 | 332.3 Da LogP 3.97 TPSA 87.7 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccccc1-c1c2ccc(=O)cc-2oc2cc(O)ccc12
|
| ZINC1592410 ZINC | 0.586 | 212.2 Da LogP 1.54 TPSA 59.9 | ✓ Ro5 | Alert |
O=C(C(=O)c1cccnc1)c1cccnc1
|
| ZINC100103222 ZINC | 0.583 | 217.1 Da LogP 1.79 TPSA 47.0 | ✓ Ro5 | ✓ Clean |
O=C(CC(=O)C(F)(F)F)c1cccnc1
|
| ZINC394078 ZINC | 0.583 | 206.3 Da LogP 2.34 TPSA 33.2 | ✓ Ro5 | ✓ Clean |
CCCN(CCC)C(=O)c1cccnc1
|
| ZINC4430794 ZINC | 0.583 | 205.3 Da LogP 2.27 TPSA 47.0 | ✓ Ro5 | ✓ Clean |
CC(C)(C)C(=O)CC(=O)c1cccnc1
|
| ZINC84193868 ZINC | 0.583 | 213.2 Da LogP 2.21 TPSA 50.2 | ✓ Ro5 | ✓ Clean |
O=C(Cc1ccc(O)cc1)c1cccnc1
|
| ZINC238651069 ZINC | 0.579 | 208.2 Da LogP 0.46 TPSA 93.3 | ✓ Ro5 | ✓ Clean |
N[C@H](CCC(=O)c1cccnc1)C(=O)O
|
| ZINC238665102 ZINC | 0.579 | 208.2 Da LogP 0.46 TPSA 93.3 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCC(=O)c1cccnc1)C(=O)O
|
| ZINC303011 ZINC | 0.575 | 283.3 Da LogP 3.07 TPSA 71.1 | ✓ Ro5 | ✓ Clean |
CCCC(=O)Nc1ccc(NC(=O)c2cccnc2)cc1
|
| ZINC5239470 ZINC | 0.575 | 207.2 Da LogP 1.66 TPSA 62.6 | ✓ Ro5 | ✓ Clean |
CN(CCCC(=O)c1cccnc1)N=O
|
| ZINC5030632 ZINC | 0.571 | 332.3 Da LogP 3.97 TPSA 87.7 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(-c2c3ccc(=O)cc-3oc3cc(O)ccc23)cc1
|
| ZINC100035725 ZINC | 0.569 | 473.4 Da LogP 3.19 TPSA 151.4 | ✓ Ro5 | ✓ Clean |
O=C(ON1C(=O)CCC1=O)c1ccc(-c2c3ccc(=O)cc-3oc3cc(…
|
| ZINC25762071 ZINC | 0.569 | 362.3 Da LogP 3.13 TPSA 139.8 | ✓ Ro5 | ✓ Clean |
Nc1cc(C(=O)O)c(-c2c3ccc(=O)cc-3oc3cc(O)ccc23)cc…
|
| ZINC100003502 ZINC | 0.568 | 207.2 Da LogP 0.40 TPSA 73.3 | ✓ Ro5 | ✓ Clean |
COC(=O)C(=O)CC(=O)c1cccnc1
|
| ZINC37992319 ZINC | 0.568 | 231.7 Da LogP 3.16 TPSA 30.0 | ✓ Ro5 | ✓ Clean |
O=C(Cc1ccc(Cl)cc1)c1cccnc1
|
| ZINC37992320 ZINC | 0.568 | 215.2 Da LogP 2.65 TPSA 30.0 | ✓ Ro5 | ✓ Clean |
O=C(Cc1ccc(F)cc1)c1cccnc1
|
| ZINC37992321 ZINC | 0.568 | 276.1 Da LogP 3.27 TPSA 30.0 | ✓ Ro5 | ✓ Clean |
O=C(Cc1ccc(Br)cc1)c1cccnc1
|
| ZINC100083975 ZINC | 0.564 | 267.3 Da LogP 3.46 TPSA 47.0 | ✓ Ro5 | ✓ Clean |
Cc1cc(C)c(C(=O)CC(=O)c2cccnc2)c(C)c1
|
| ZINC100085501 ZINC | 0.564 | 221.2 Da LogP 0.79 TPSA 73.3 | ✓ Ro5 | ✓ Clean |
CCOC(=O)C(=O)CC(=O)c1cccnc1
|
| ZINC37464014 ZINC | 0.564 | 211.3 Da LogP 2.82 TPSA 30.0 | ✓ Ro5 | ✓ Clean |
Cc1cccc(CC(=O)c2cccnc2)c1
|
| ZINC38125314 ZINC | 0.564 | 227.3 Da LogP 2.52 TPSA 39.2 | ✓ Ro5 | ✓ Clean |
COc1ccc(CC(=O)c2cccnc2)cc1
|
| ZINC22063503 ZINC | 0.561 | 221.3 Da LogP 2.05 TPSA 62.6 | ✓ Ro5 | ✓ Clean |
CN(CCCCC(=O)c1cccnc1)N=O
|
| ZINC1667326 ZINC | 0.553 | 384.4 Da LogP 1.90 TPSA 112.5 | ✓ Ro5 | ✓ Clean |
CCOC(=O)[C@H](C(=O)c1cccnc1)[C@H](C(=O)OCC)C(=O…
|
| ZINC1667329 ZINC | 0.553 | 384.4 Da LogP 1.90 TPSA 112.5 | ✓ Ro5 | ✓ Clean |
CCOC(=O)[C@@H](C(=O)c1cccnc1)[C@@H](C(=O)OCC)C(…
|
| ZINC17299137 ZINC | 0.553 | 384.4 Da LogP 1.90 TPSA 112.5 | ✓ Ro5 | ✓ Clean |
CCOC(=O)[C@H](C(=O)c1cccnc1)[C@@H](C(=O)OCC)C(=…
|
| ZINC2765515 ZINC | 0.553 | 234.3 Da LogP 3.12 TPSA 33.2 | ✓ Ro5 | ✓ Clean |
CCCCN(CCCC)C(=O)c1cccnc1
|
| ZINC36941212 ZINC | 0.553 | 225.3 Da LogP 3.27 TPSA 30.0 | ✓ Ro5 | ✓ Clean |
CCCc1ccc(C(=O)c2cccnc2)cc1
|
| ZINC380074941 ZINC | 0.550 | 222.2 Da LogP 0.66 TPSA 88.9 | ✓ Ro5 | ✓ Clean |
COC(=O)C(CC(=O)c1cccnc1)=NO
|
| ZINC88616762 ZINC | 0.550 | 222.2 Da LogP 0.66 TPSA 88.9 | ✓ Ro5 | ✓ Clean |
COC(=O)/C(CC(=O)c1cccnc1)=N/O
|
| ZINC575443691 ZINC | 0.548 | 268.4 Da LogP 3.18 TPSA 33.2 | ✓ Ro5 | ✓ Clean |
CN(CCCC(=O)c1cccnc1)Cc1ccccc1
|
| ZINC584908924 ZINC | 0.548 | 251.3 Da LogP 1.62 TPSA 65.5 | ✓ Ro5 | ✓ Clean |
COCCCOC(=O)CCC(=O)c1cccnc1
|
| ZINC45028802 ZINC | 0.543 | 211.3 Da LogP 2.93 TPSA 30.0 | ✓ Ro5 | ✓ Clean |
Cc1cccc(C)c1C(=O)c1cccnc1
|
| ZINC25781561 ZINC | 0.542 | 421.4 Da LogP 3.13 TPSA 137.8 | ✓ Ro5 | ✓ Clean |
NNC(=S)Nc1ccc(-c2c3ccc(=O)cc-3oc3cc(O)ccc23)c(C…
|
| ZINC22121726 ZINC | 0.541 | 211.3 Da LogP 2.88 TPSA 30.0 | ✓ Ro5 | ✓ Clean |
CCc1ccc(C(=O)c2cccnc2)cc1
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.