Protein target profile

VK055_1151

major Facilitator Superfamily protein

Genome: KpATCC43816 Gene: AIK79775.1 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GM25
Length 463
Pocket druggability 0.997
Direct ligand evidence 0 60 total records
Functional annotation 0 EC 2 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
0.6% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
27.794 Higher values support similarity to known essential genes.

Localization

Localization
CytoplasmicMembrane

Structure confidence

ColabFold pLDDT
92.93 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

The selected pocket score is the FPocket value used for ranking after applying the curated structure priority. It estimates small-molecule pocket quality; it is not experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

FPocket 0.997
Structure A0A0H3GM25
Pocket Pocket 1
P2Rank 0.994
Structure A0A0H3GM25
Pocket Pocket 1
ColabFold model
FPocket 0.709 · Pocket 21
P2Rank 0.988 · Pocket 1
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 27 / 4744 genomes with a hit
Prevalence 0.6%

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Sequence

Primary amino-acid sequence viewer.

MSTVTISDTPFVGNDRLLVGIVLSVLTFWLFAQSVINVVPAMKSSLDISLETLTLAVSLSALFSGCFVVASGGLADKFGRMRMTTLGLGLSIVGSAMLVVAQGPGLFLAGRVLQGLSAACIMPATLALIKTWYEGRARQRAVSFWVIGSWGGSGLCSFVGGAIATGLGWRWIFVFSIAVALLALFLLRGTPESRSASASQHKLDVGGLLSLIVALVLVNLFISKGHGWGWSSPLSLTMLAGALAAGTIFIRNGMRKGEAALIDFALFRNRAYGAAVLSNFLLNGAIGTMMIASIWLQQGHHLTPLESGMMTLGYLVTVLAMIRVGEKLLQRYGARLPMMAGPVLTAIAIALISCTFLEKALYIRVVFASNVLFGLGLGCYATPSTDTAVANAPENKIGVASGIYKMGSSLGGAMGIAVTASLFALFLPLGMAHAAQYALWFNAVLCLGAMAVSALLLPRASHS

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

2 GO

Gene Ontology (GO)

2
  • GO:0022857 Enables the transfer of a substance, usually a specific substance or a group of related substances, from one side of a membrane to the other.
  • GO:0055085 The process in which a solute is transported across a lipid bilayer, from one side of a membrane to the other.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

56 records
Show feature table
Start End DB Term Name
112 129 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
167 186 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
410 432 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
223 227 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
188 202 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
141 163 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
410 431 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
296 306 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
362 381 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
307 324 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
437 457 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
432 436 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
112 129 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
20 42 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
52 74 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
308 325 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
17 457 PANTHER PTHR42718 MAJOR FACILITATOR SUPERFAMILY MULTIDRUG TRANSPORTER MFSC
325 335 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
86 106 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
141 163 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
228 250 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
107 111 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
336 356 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
436 458 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
206 223 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
228 250 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
203 222 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
37 55 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
164 168 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
169 187 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
17 218 Gene3D G3DSA:1.20.1720.10 Multidrug resistance protein D
17 36 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
360 382 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
281 460 Pfam PF07690 Major Facilitator Superfamily
281 460 InterPro IPR011701 Major facilitator superfamily
23 242 Pfam PF07690 Major Facilitator Superfamily
23 242 InterPro IPR011701 Major facilitator superfamily
130 140 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
17 461 ProSiteProfiles PS50850 Major facilitator superfamily (MFS) profile.
17 461 InterPro IPR020846 Major facilitator superfamily domain
271 293 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
251 270 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
458 463 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
357 361 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
382 409 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
56 74 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
75 85 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
271 295 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
332 354 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
21 457 CDD cd17321 MFS_MMR_MDR_like
86 108 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
1 16 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
264 463 Gene3D G3DSA:1.20.1250.20 MFS general substrate transporter like domains
264 463 InterPro IPR036259 MFS transporter superfamily
15 460 SUPERFAMILY SSF103473 MFS general substrate transporter
15 460 InterPro IPR036259 MFS transporter superfamily

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · FPocket

Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Site 1 FPocket #1
0.997
Likely same site as P2Rank 1 7.9 Å 47 shared residues 84% of smaller site
Unusual size
Show in viewer
Surrounding area
Site 2 FPocket #19
0.596
Unusual size
Show in viewer
Surrounding area
Site 3 FPocket #9
0.36
Likely same site as P2Rank 5 1.6 Å 8 shared residues 100% of smaller site
Show in viewer
Surrounding area

Binding pockets · P2Rank

Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Site 1 P2Rank #1
0.994
Likely same site as FPocket 1 7.9 Å 47 shared residues 84% of smaller site
Show in viewer
Surrounding area
Site 2 P2Rank #2
0.72
Show in viewer
Surrounding area
Site 3 P2Rank #3
0.109
Show in viewer
Surrounding area
Site 4 P2Rank #4
0.102
Show in viewer
Surrounding area
Site 5 P2Rank #5
0.086
Likely same site as FPocket 9 1.6 Å 8 shared residues 100% of smaller site
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GM25
AlphaFold DB full sequence Viewing
ColabFold VK055_1151
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

60 records
Chemistry signal

Bioactivity evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 10 records from similar proteins
Structural ligands 0 0 loaded crystals
Measured bioactivity 10 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
4YH ChEMBL via homolog 454.6 Da · LogP 5.09 · TPSA 64.0 Open detail ChEMBL
CHEMBL1502567 ChEMBL via homolog Detail ChEMBL
CHEMBL224214 ChEMBL via homolog Detail ChEMBL
CHEMBL4164617 ChEMBL via homolog Detail ChEMBL
CHEMBL4168026 ChEMBL via homolog Detail ChEMBL

Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).

Show only:
Ligand UniProt (homolog) pchembl MW · LogP · TPSA Lipinski PAINS SMILES
4YH ChEMBL A0R5K5 454.6 Da LogP 5.09 TPSA 64.0 1 viol. ✓ Clean CC(C)C(CCCN(C)CCc1ccc(c(c1)OC)OC)(C#N)c2ccc(c(c…
CHEMBL1502567 ChEMBL A0R5K5 196.2 Da LogP 1.85 TPSA 34.4 ✓ Ro5 ✓ Clean O=c1c2ccccc2nc2ccccn12
CHEMBL224214 ChEMBL A0R5K5 204.6 Da LogP 2.16 TPSA 72.0 ✓ Ro5 Alert N#CC(C#N)=NNc1cccc(Cl)c1
CHEMBL4164617 ChEMBL A0R5K5 265.1 Da LogP 3.15 TPSA 34.4 ✓ Ro5 ✓ Clean O=c1c2cccc(Cl)c2nc2c(Cl)cccn12
CHEMBL4168026 ChEMBL A0R5K5 232.2 Da LogP 2.13 TPSA 34.4 ✓ Ro5 ✓ Clean O=c1c2ccccc2nc2c(F)cc(F)cn12
CHEMBL4169953 ChEMBL A0R5K5 244.7 Da LogP 2.81 TPSA 34.4 ✓ Ro5 ✓ Clean Cc1cccn2c(=O)c3cccc(Cl)c3nc12
CHEMBL4171005 ChEMBL A0R5K5 230.7 Da LogP 2.50 TPSA 34.4 ✓ Ro5 ✓ Clean O=c1c2ccc(Cl)cc2nc2ccccn12
CHEMBL4171337 ChEMBL A0R5K5 210.2 Da LogP 2.16 TPSA 34.4 ✓ Ro5 ✓ Clean Cc1cccn2c(=O)c3ccccc3nc12
CHEMBL4172500 ChEMBL A0R5K5 248.6 Da LogP 2.64 TPSA 34.4 ✓ Ro5 ✓ Clean O=c1c2cccc(Cl)c2nc2ccc(F)cn12
CHEMBL4172832 ChEMBL A0R5K5 228.2 Da LogP 2.30 TPSA 34.4 ✓ Ro5 ✓ Clean Cc1ccn2c(=O)c3cccc(F)c3nc2c1

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.