KpATCC43816 Protein target profile

acyl-CoA thioesterase

Accession: VK055_1214

Gene: AIK79837.1 yciA 3D evidence: AlphaFold DB model + ColabFold model Metabolism 19 reactions UniProt A0A0H3GS03
Length 114
Pocket druggability (P2Rank · AlphaFold DB model) 0.023
Metabolic reactions 19
Chokepoint No
Direct ligand evidence 0 50 total records
Functional annotation 0 EC 5 GO
Target summary

Target candidate with partial support; inspect missing evidence before prioritizing.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
30.973 Lower values reduce human off-target concern.
Human E-value
1.42e-09
Gut microbiome similarity
3.6% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
88.596 Higher values support similarity to known essential genes.
DEG E-value
1.73e-73 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
96.9 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.023
Structure A0A0H3GS03
Pocket Pocket 1
Druggability (FPocket) 0.261
Structure A0A0H3GS03
Pocket Pocket 6
ColabFold model
FPocket 0.808 · Pocket 1
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 171 / 4744 genomes with a hit
Prevalence 3.6%

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

Explore metabolic network
Relative network centrality 0.0% more central than 0.0% of genes in this genome
Chokepoint Not a chokepoint
Pathways

No specific KEGG pathway assigned - this reaction either has no KEGG mapping, or only matches a generic overview map with no route-level information.

Catalyzed reactions

19 reactions mapped to this gene in the metabolic model. Open the full network to see each one, with substrates/products and the reaction-reaction map.

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MPADTNANGDIFGGWLMSQMDIGGAIMAKEIAQGRVVTVRVDGMTFLRPVAVGDVVCCYARCVKRGNTSVTINIEVWVKKVSSEPIGQRYKATEALFIYVAVDNQGKPRPLPAE

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

5 GO

Subcellular localization

Localization
Unknown

Gene Ontology (GO)

5
  • GO:0016790 Catalysis of the reaction: RCO-SR' + H2O = RCOOH + HSR'. This reaction is the hydrolysis of a thiolester bond, an ester formed from a carboxylic acid and a thiol (i.e., RCO-SR'), such as that found in acetyl-coenzyme A.
  • GO:0005829 The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
  • GO:0052816 Catalysis of the reaction: a long-chain fatty acyl-CoA + H2O = a long-chain fatty acid + CoA + H+. A long-chain fatty acid has an aliphatic tail containing 13 to 22 carbons.
  • GO:0006637 The chemical reactions and pathways involving acyl-CoA, any derivative of coenzyme A in which the sulfhydryl group is in thiolester linkage with an acyl group.
  • GO:0009062 The chemical reactions and pathways resulting in the breakdown of a fatty acid, any of the aliphatic monocarboxylic acids that can be liberated by hydrolysis from naturally occurring fats and oils. Fatty acids are predominantly straight-chain acids of 4 to 24 carbon atoms, which may be saturated or unsaturated; branched fatty acids and hydroxy fatty acids also occur, and very long chain acids of over 30 carbons are found in waxes.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

11 records
Show feature table
Start End DB Term Name
1 114 Gene3D G3DSA:3.10.129.10 Hotdog Thioesterase
8 79 Pfam PF03061 Thioesterase superfamily
8 79 InterPro IPR006683 Thioesterase domain
1 113 SUPERFAMILY SSF54637 Thioesterase/thiol ester dehydrase-isomerase
1 113 InterPro IPR029069 HotDog domain superfamily
1 112 PANTHER PTHR11049 ACYL COENZYME A THIOESTER HYDROLASE
1 112 InterPro IPR040170 Cytosolic acyl coenzyme A thioester hydrolase
1 112 CDD cd03442 BFIT_BACH
1 114 FunFam G3DSA:3.10.129.10:FF:000008 Acyl-CoA thioester hydrolase
1 105 ProSiteProfiles PS51770 Hotdog acyl-CoA thioesterase (ACOT)-type domain profile.
1 105 InterPro IPR033120 Hotdog acyl-CoA thioesterase (ACOT)-type domain

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.023
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.009
Likely same site as FPocket 6 7.6 Å 2 shared residues 67% of smaller site
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #6
0.261
Likely same site as P2Rank 2 7.6 Å 2 shared residues 67% of smaller site
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GS03
AlphaFold DB full sequence Viewing
ColabFold VK055_1214
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

50 records
Chemistry signal

Structural and bioactivity evidence are both available for this target.

Direct evidence 0 same-protein records
Transferred evidence 3 records from similar proteins
Structural ligands 2 0 loaded crystals
Measured bioactivity 1 direct and transferred ChEMBL records
Proposed compounds 47 similarity-based ZINC candidates
Best available ligand signal
5NG PDB via homolog 1533.1 Da · LogP -2.80 · TPSA 693.1 Open detail RCSB PDB
BCO PDB via homolog Detail RCSB PDB
DWT ChEMBL via homolog · pchembl 6.78 (~166.0 nM) Detail ChEMBL
ZINC1532902 ZINC proposed compound · Tanimoto 0.700 Detail ZINC
ZINC2018106 ZINC proposed compound · Tanimoto 0.700 Detail ZINC

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
5NG RCSB PDB A0A0H3K033 1533.1 Da LogP -2.80 TPSA 693.1 3 viol. ✓ Clean CC(C)(COP(=O)(O)OP(=O)(O)OC[C@@H]1[C@H]([C@H]([…
BCO RCSB PDB A0A0H3K033 837.6 Da LogP -0.54 TPSA 363.6 3 viol. ✓ Clean CCCC(=O)SCCNC(=O)CCNC(=O)[C@@H](C(C)(C)COP(=O)(…

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Pathways

BioCyc RXN0-5390 BioCyc THIOESTER-RXN[CCO-CYTOSOL]-ARACHIDONYL-COA/WATER//ARACHIDONIC_ACID/CO-A/PROTON.65. BioCyc THIOESTER-RXN[CCO-CYTOSOL]-BUTYRYL-COA/WATER//BUTYRIC_ACID/CO-A/PROTON.57. BioCyc THIOESTER-RXN[CCO-CYTOSOL]-CPD-10267/WATER//CPD-3617/CO-A/PROTON.51. BioCyc THIOESTER-RXN[CCO-CYTOSOL]-CPD-196/WATER//CPD-195/CO-A/PROTON.48. BioCyc THIOESTER-RXN[CCO-CYTOSOL]-OLEOYL-COA/WATER//OLEATE-CPD/CO-A/PROTON.54. BioCyc THIOESTER-RXN[CCO-CYTOSOL]-PALMITYL-COA/WATER//PALMITATE/CO-A/PROTON.55. BioCyc THIOESTER-RXN[CCO-CYTOSOL]-PENTANOYLCOA-CPD/WATER//VALERATE/CO-A/PROTON.58. BioCyc THIOESTER-RXN[CCO-CYTOSOL]-PROPIONYL-COA/WATER//PROPIONATE/CO-A/PROTON.57. BioCyc THIOESTER-RXN[CCO-CYTOSOL]-STEAROYL-COA/WATER//STEARIC_ACID/CO-A/PROTON.58. BioCyc THIOESTER-RXN[CCO-PERI-BAC]-ARACHIDONYL-COA/WATER//ARACHIDONIC_ACID/CO-A/PROTON.66. BioCyc THIOESTER-RXN[CCO-PERI-BAC]-BUTYRYL-COA/WATER//BUTYRIC_ACID/CO-A/PROTON.58. BioCyc THIOESTER-RXN[CCO-PERI-BAC]-CPD-10267/WATER//CPD-3617/CO-A/PROTON.52. BioCyc THIOESTER-RXN[CCO-PERI-BAC]-CPD-196/WATER//CPD-195/CO-A/PROTON.49. BioCyc THIOESTER-RXN[CCO-PERI-BAC]-OLEOYL-COA/WATER//OLEATE-CPD/CO-A/PROTON.55. BioCyc THIOESTER-RXN[CCO-PERI-BAC]-PALMITYL-COA/WATER//PALMITATE/CO-A/PROTON.56. BioCyc THIOESTER-RXN[CCO-PERI-BAC]-PENTANOYLCOA-CPD/WATER//VALERATE/CO-A/PROTON.59. BioCyc THIOESTER-RXN[CCO-PERI-BAC]-PROPIONYL-COA/WATER//PROPIONATE/CO-A/PROTON.58. BioCyc THIOESTER-RXN[CCO-PERI-BAC]-STEAROYL-COA/WATER//STEARIC_ACID/CO-A/PROTON.59.