Promising target candidate with multiple supporting evidence streams.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Evidence coverage
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- No hit
- Gut microbiome similarity
- 1.7% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- N
- DEG identity (%)
- 38.596 Higher values support similarity to known essential genes.
Structure confidence
- ColabFold pLDDT
- 92.48 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MLKMIDVVAAIIEQDGQILLAQRPPHADQPGMWEFAGGKVEPGESQPQALVRELQEEMGIIARPACYIASHQREVSGRRIHLHAWWVPHFQGTPLAHYHTQLRWCRPTEALALDLAPADIPLLHAFIAQRPTLSVR
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- Cytoplasmic
Gene Ontology (GO)
2- GO:0006281 The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
- GO:0016787 Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 3 | 128 | ProSiteProfiles | PS51462 | Nudix hydrolase domain profile. |
| 3 | 128 | InterPro | IPR000086 | NUDIX hydrolase domain |
| 2 | 131 | PANTHER | PTHR47707 | 8-OXO-DGTP DIPHOSPHATASE |
| 2 | 131 | InterPro | IPR047127 | Mutator MutT-like |
| 6 | 125 | Pfam | PF00293 | NUDIX domain |
| 6 | 125 | InterPro | IPR000086 | NUDIX hydrolase domain |
| 5 | 125 | CDD | cd03425 | MutT_pyrophosphohydrolase |
| 3 | 126 | SUPERFAMILY | SSF55811 | Nudix |
| 3 | 126 | InterPro | IPR015797 | NUDIX hydrolase-like domain superfamily |
| 33 | 47 | PRINTS | PR00502 | NUDIX hydrolase family signature |
| 33 | 47 | InterPro | IPR020476 | NUDIX hydrolase |
| 47 | 62 | PRINTS | PR00502 | NUDIX hydrolase family signature |
| 47 | 62 | InterPro | IPR020476 | NUDIX hydrolase |
| 2 | 130 | FunFam | G3DSA:3.90.79.10:FF:000014 | 8-oxo-dGTP diphosphatase MutT |
| 1 | 134 | Gene3D | G3DSA:3.90.79.10 | Nucleoside Triphosphate Pyrophosphohydrolase |
| 38 | 59 | ProSitePatterns | PS00893 | Nudix box signature. |
| 38 | 59 | InterPro | IPR020084 | NUDIX hydrolase, conserved site |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GLS0
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
VK055_1247
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural ligand evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| 523 RCSB PDB | A0R2K6 | 482.2 Da LogP -1.46 TPSA 252.0 | 1 viol. | ✓ Clean |
CC1=C(NC(=O)[N+](=C1)[C@H]2C[C@@H]([C@H](O2)CO[…
|
|
| 5FA RCSB PDB | Q75UV1 | 667.1 Da LogP -1.40 TPSA 372.2 | 3 viol. | ✓ Clean |
c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
|
|
| 8OG RCSB PDB | P08337 | 363.2 Da LogP -2.25 TPSA 205.8 | 1 viol. | ✓ Clean |
C1[C@@H]([C@H](O[C@H]1N2C3=C(C(=O)NC(=N3)N)NC2=…
|
|
| 9L3 RCSB PDB | A0R2K6 | 306.2 Da LogP -0.98 TPSA 139.0 | ✓ Ro5 | ✓ Clean |
Cc1c[n+](cnc1N)[C@H]2C[C@@H]([C@H](O2)COP(=O)(O…
|
|
| APC RCSB PDB | P08337 | 505.2 Da LogP -1.52 TPSA 269.9 | 3 viol. | ✓ Clean |
c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
|
|
| DCP RCSB PDB | A0R2K6 | 467.2 Da LogP -1.18 TPSA 250.2 | 2 viol. | ✓ Clean |
C1[C@@H]([C@H](O[C@H]1N2C=CC(=NC2=O)N)CO[P@@](=…
|
|
| GNP RCSB PDB | Q9RVK2 | 522.2 Da LogP -2.76 TPSA 301.9 | 3 viol. | ✓ Clean |
c1nc2c(n1[C@H]3[C@@H]([C@@H]([C@H](O3)CO[P@](=O…
|
|
| PPV RCSB PDB | P0AFC0 | 178.0 Da LogP -0.81 TPSA 124.3 | ✓ Ro5 | ✓ Clean |
OP(=O)(O)OP(=O)(O)O
|
|
| TLA RCSB PDB | P08337 | 150.1 Da LogP -2.12 TPSA 115.1 | ✓ Ro5 | ✓ Clean |
[C@@H]([C@H](C(=O)O)O)(C(=O)O)O
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC12503365 ZINC | 1.000 | 467.2 Da LogP -1.18 TPSA 250.2 | 2 viol. | ✓ Clean |
Nc1ccn([C@H]2C[C@@H](O)[C@@H](CO[P@](=O)(O)O[P@…
|
| ZINC104869865 ZINC | 0.836 | 443.2 Da LogP -2.45 TPSA 252.6 | 2 viol. | ✓ Clean |
Nc1nc2c(ncn2[C@H]2O[C@H](CO[P@@](=O)(O)OP(=O)(O…
|
| ZINC12504289 ZINC | 0.836 | 443.2 Da LogP -2.45 TPSA 252.6 | 2 viol. | ✓ Clean |
Nc1nc2c(ncn2[C@@H]2O[C@H](CO[P@@](=O)(O)OP(=O)(…
|
| ZINC34541308 ZINC | 0.836 | 443.2 Da LogP -2.45 TPSA 252.6 | 2 viol. | ✓ Clean |
Nc1nc2c(ncn2[C@@H]2O[C@H](CO[P@@](=O)(O)OP(=O)(…
|
| ZINC35000839 ZINC | 0.836 | 443.2 Da LogP -2.45 TPSA 252.6 | 2 viol. | ✓ Clean |
Nc1nc2c(ncn2[C@H]2O[C@@H](CO[P@@](=O)(O)OP(=O)(…
|
| ZINC45284491 ZINC | 0.836 | 443.2 Da LogP -2.45 TPSA 252.6 | 2 viol. | ✓ Clean |
Nc1nc2c(ncn2[C@H]2O[C@@H](CO[P@@](=O)(O)OP(=O)(…
|
| ZINC80639694 ZINC | 0.836 | 443.2 Da LogP -2.45 TPSA 252.6 | 2 viol. | ✓ Clean |
Nc1nc2c(ncn2[C@@H]2O[C@H](CO[P@@](=O)(O)OP(=O)(…
|
| ZINC8215481 ZINC | 0.836 | 443.2 Da LogP -2.45 TPSA 252.6 | 2 viol. | ✓ Clean |
Nc1nc2c(ncn2[C@@H]2O[C@H](CO[P@@](=O)(O)OP(=O)(…
|
| ZINC12359024 ZINC | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@@H](O)[C@H](O)[C@H](O)[C@@H](O)C(=O)O
|
| ZINC13533920 ZINC | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@@H](O)[C@H](O)[C@@H](O)[C@@H](O)C(=O)O
|
| ZINC1532740 ZINC | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@@H](O)[C@H](O)[C@@H](O)[C@H](O)C(=O)O
|
| ZINC1549593 ZINC | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@H](O)[C@H](O)[C@@H](O)[C@@H](O)C(=O)O
|
| ZINC2013424 ZINC | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@@H](O)[C@@H](O)[C@@H](O)[C@H](O)C(=O)O
|
| ZINC3581021 ZINC | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@H](O)[C@@H](O)[C@@H](O)[C@@H](O)C(=O)O
|
| ZINC3860635 ZINC | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)C(=O)O
|
| ZINC5783661 ZINC | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C(=O)O
|
| ZINC6072527 ZINC | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@@H](O)[C@@H](O)[C@@H](O)[C@@H](O)C(=O)O
|
| ZINC6827739 ZINC | 0.692 | 258.0 Da LogP -0.69 TPSA 170.8 | ✓ Ro5 | ✓ Clean |
O=P(O)(O)OP(=O)(O)OP(=O)(O)O
|
| ZINC11612315 ZINC | 0.642 | 227.2 Da LogP -1.53 TPSA 110.6 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@@H]2C[C@@H](O)[C@@H](CO)O2)c(=O)n1
|
| ZINC18286010 ZINC | 0.642 | 227.2 Da LogP -1.53 TPSA 110.6 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@@H]2C[C@H](O)[C@@H](CO)O2)c(=O)n1
|
| ZINC18286013 ZINC | 0.642 | 227.2 Da LogP -1.53 TPSA 110.6 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@H]2C[C@H](O)[C@@H](CO)O2)c(=O)n1
|
| ZINC34235488 ZINC | 0.642 | 226.2 Da LogP -1.57 TPSA 116.4 | ✓ Ro5 | ✓ Clean |
NC[C@H]1O[C@@H](n2ccc(N)nc2=O)C[C@@H]1O
|
| ZINC3869837 ZINC | 0.642 | 227.2 Da LogP -1.53 TPSA 110.6 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@H]2C[C@H](O)[C@H](CO)O2)c(=O)n1
|
| ZINC3869838 ZINC | 0.642 | 227.2 Da LogP -1.53 TPSA 110.6 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@H]2C[C@@H](O)[C@H](CO)O2)c(=O)n1
|
| ZINC4253 ZINC | 0.642 | 227.2 Da LogP -1.53 TPSA 110.6 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@@H]2C[C@@H](O)[C@H](CO)O2)c(=O)n1
|
| ZINC5239365 ZINC | 0.642 | 227.2 Da LogP -1.53 TPSA 110.6 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@H]2C[C@@H](O)[C@@H](CO)O2)c(=O)n1
|
| ZINC57290 ZINC | 0.642 | 227.2 Da LogP -1.53 TPSA 110.6 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@@H]2C[C@H](O)[C@H](CO)O2)c(=O)n1
|
| ZINC100058967 ZINC | 0.632 | 443.2 Da LogP -2.45 TPSA 252.6 | 2 viol. | ✓ Clean |
Nc1nc(=O)c2ncn([C@H]3O[C@H](CO[P@](=O)(O)OP(=O)…
|
| ZINC12504287 ZINC | 0.632 | 443.2 Da LogP -2.45 TPSA 252.6 | 2 viol. | ✓ Clean |
Nc1nc(=O)c2ncn([C@@H]3O[C@@H](CO[P@@](=O)(O)OP(…
|
| ZINC12504288 ZINC | 0.632 | 443.2 Da LogP -2.45 TPSA 252.6 | 2 viol. | ✓ Clean |
Nc1nc(=O)c2ncn([C@H]3O[C@@H](CO[P@@](=O)(O)OP(=…
|
| ZINC31308647 ZINC | 0.632 | 443.2 Da LogP -2.45 TPSA 252.6 | 2 viol. | ✓ Clean |
Nc1nc(=O)c2ncn([C@@H]3O[C@@H](CO[P@@](=O)(O)OP(…
|
| ZINC106686432 ZINC | 0.627 | 428.2 Da LogP -2.03 TPSA 226.5 | 2 viol. | ✓ Clean |
O=c1[nH]cnc2c1ncn2[C@H]1O[C@@H](CO[P@](=O)(O)OP…
|
| ZINC12958393 ZINC | 0.627 | 428.2 Da LogP -2.03 TPSA 226.5 | 2 viol. | ✓ Clean |
O=c1[nH]cnc2c1ncn2[C@@H]1O[C@@H](CO[P@](=O)(O)O…
|
| ZINC35024781 ZINC | 0.627 | 428.2 Da LogP -2.03 TPSA 226.5 | 2 viol. | ✓ Clean |
O=c1[nH]cnc2c1ncn2[C@H]1O[C@@H](CO[P@@](=O)(O)O…
|
| ZINC35024785 ZINC | 0.627 | 428.2 Da LogP -2.03 TPSA 226.5 | 2 viol. | ✓ Clean |
O=c1[nH]cnc2c1ncn2[C@H]1O[C@@H](CO[P@@](=O)(O)O…
|
| ZINC35024786 ZINC | 0.627 | 428.2 Da LogP -2.03 TPSA 226.5 | 2 viol. | ✓ Clean |
O=c1[nH]cnc2c1ncn2[C@@H]1O[C@@H](CO[P@@](=O)(O)…
|
| ZINC4261903 ZINC | 0.627 | 428.2 Da LogP -2.03 TPSA 226.5 | 2 viol. | ✓ Clean |
O=c1[nH]cnc2c1ncn2[C@@H]1O[C@H](CO[P@@](=O)(O)O…
|
| ZINC80601236 ZINC | 0.627 | 428.2 Da LogP -2.03 TPSA 226.5 | 2 viol. | ✓ Clean |
O=c1[nH]cnc2c1ncn2[C@@H]1O[C@H](CO[P@@](=O)(O)O…
|
| ZINC95921560 ZINC | 0.627 | 428.2 Da LogP -2.03 TPSA 226.5 | 2 viol. | ✓ Clean |
O=c1[nH]cnc2c1ncn2[C@H]1O[C@@H](CO[P@@](=O)(O)O…
|
| ZINC2047403 ZINC | 0.618 | 267.2 Da LogP -1.98 TPSA 139.5 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](CO)[C@@H](O)[C@@H]1O
|
| ZINC3201878 ZINC | 0.618 | 267.2 Da LogP -1.98 TPSA 139.5 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](CO)[C@@H](O)[C@@H]…
|
| ZINC3814316 ZINC | 0.618 | 266.3 Da LogP -2.01 TPSA 145.3 | ✓ Ro5 | ✓ Clean |
NC[C@H]1O[C@@H](n2cnc3c(N)ncnc32)[C@H](O)[C@@H]…
|
| ZINC3830178 ZINC | 0.618 | 267.2 Da LogP -1.98 TPSA 139.5 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](CO)[C@@H](O)[C@H]1O
|
| ZINC3978047 ZINC | 0.618 | 267.2 Da LogP -1.98 TPSA 139.5 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](CO)[C@H](O)[C@H]1O
|
| ZINC4773848 ZINC | 0.618 | 266.3 Da LogP -2.01 TPSA 145.3 | ✓ Ro5 | ✓ Clean |
NC[C@@H]1O[C@H](n2cnc3c(N)ncnc32)[C@H](O)[C@@H]…
|
| ZINC4773849 ZINC | 0.618 | 266.3 Da LogP -2.01 TPSA 145.3 | ✓ Ro5 | ✓ Clean |
NC[C@@H]1O[C@@H](n2cnc3c(N)ncnc32)[C@H](O)[C@@H…
|
| ZINC4773851 ZINC | 0.618 | 266.3 Da LogP -2.01 TPSA 145.3 | ✓ Ro5 | ✓ Clean |
NC[C@@H]1O[C@@H](n2cnc3c(N)ncnc32)[C@@H](O)[C@@…
|
| ZINC77981211 ZINC | 0.618 | 266.3 Da LogP -2.01 TPSA 145.3 | ✓ Ro5 | ✓ Clean |
NC[C@H]1O[C@@H](n2cnc3c(N)ncnc32)[C@@H](O)[C@H]…
|
| ZINC82228511 ZINC | 0.618 | 266.3 Da LogP -2.01 TPSA 145.3 | ✓ Ro5 | ✓ Clean |
NC[C@H]1O[C@@H](n2cnc3c(N)ncnc32)[C@H](O)[C@H]1O
|
| ZINC8580514 ZINC | 0.618 | 267.2 Da LogP -1.98 TPSA 139.5 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CO)[C@H](O)[C@@H]1O
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.