Protein target profile
VK055_1357
tonB-dependent siderophore receptor family protein
Promising target candidate with multiple supporting evidence streams.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- No hit
- Gut microbiome similarity
- 1.4% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- N
- DEG identity (%)
- 0.0 Higher values support similarity to known essential genes.
Localization
- Localization
- OuterMembrane
Structure confidence
- ColabFold pLDDT
- 91.83 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelThe selected pocket score is the FPocket value used for ranking after applying the curated structure priority. It estimates small-molecule pocket quality; it is not experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.
Sequence
Sequence
Primary amino-acid sequence viewer.
MDMKKRLWVLHPLLLASTLPALAAQSDEDSIIVSANRTHRTVAEMAQTTWVIEGQEIEQQVQGGKEFKDVLAQLIPGIDVSSQGRTNYGMNMRGRAIVVLIDGVRLNSSRTDSRQLDAIDPFNIEHIEVISGATSLYGGGSTGGLINIVTKKGQQDRQVDLEVGSKSGFANSNDHDERVAAAVSGGTDHASGRLSVAYQRFGGWYDGNNDALILDNTQTGLQHSDRLDVMGTGTIEIDDNRQLQLVTQYYKSQGDDDYGLWLGKNMSAVTSGGKAYTTDGLNSDRIPGTERHLISLQYSDADFFGQNLVSQVYYRDESLTFYPFPTLTKGQVSSFSSSQQDTDQYGAKLTLNSQPLAGWDLTWGLDADHETFNANQMFFDLPQSMASGGLHNESIYTTGRYPGYSISNVAPFLQSSYDLNDIFTVSGGVRYQWTENRVDDFVGYAQQQDIANGKARSADAIKGGKTDYDNFLFNAGIVAHLTERQQTWFNFSQGVELPDPGKYYGIGKYGAAVNGHLPLISSVNVDDSPLQGIKVNSYELGWRYTGDNLRTQLAAYYSTSDKTIVVNRTDMTIDVQSDKRRIYGVEGAVDYFIPDSDWSVGGNFNVLKSQVQTDGRWQKWDVTLASPSKATAWVGWAPDPWSLRVQSQQVFDLSDAAGNKLEGYNTVDFIGSYALPVGKLTFSIENLLNEDYVTIWGQRAPLLYSPTYGSSSLYEYKGRGRTFGLNYALTF
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Gene Ontology (GO)
6- GO:0015343 Enables the transfer of a solute or solutes from one side of a membrane to the other according to the reaction: siderophore-iron(out) + H+(out) = siderophore-iron(in) + H+(in).
- GO:0038023 Receiving a signal and transmitting it in the cell to initiate a change in cell activity. A signal is a physical entity or change in state that is used to transfer information in order to trigger a response.
- GO:0009279 A lipid bilayer that forms the outermost membrane of the cell envelope; enriched in polysaccharide and protein; the outer leaflet of the membrane contains specific lipopolysaccharide structures.
- GO:0015891 The directed movement of siderophores, low molecular weight Fe(III)-chelating substances, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
- GO:0015344 Enables the transfer of a solute or solutes from one side of a membrane to the other according to the reaction: siderophore-iron(ferrioxamine)(out) + H+(out) = siderophore-iron(ferrioxamine)(in) + H+(in).
- GO:0044718 The directed movement of siderophores, low molecular weight Fe(III)-chelating substances, from one side of a membrane to the other, by means of some agent such as a transporter or pore.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 21 | 154 | FunFam | G3DSA:2.170.130.10:FF:000011 | TonB-dependent siderophore receptor |
| 1 | 23 | Phobius | SIGNAL_PEPTIDE | Signal peptide region |
| 1 | 23 | SignalP_GRAM_NEGATIVE | SignalP-noTM | SignalP-noTM |
| 7 | 19 | Phobius | SIGNAL_PEPTIDE_H_REGION | Hydrophobic region of a signal peptide. |
| 22 | 155 | Gene3D | G3DSA:2.170.130.10 | - |
| 22 | 155 | InterPro | IPR037066 | TonB-dependent receptor, plug domain superfamily |
| 48 | 731 | CDD | cd01347 | ligand_gated_channel |
| 1 | 23 | SignalP_GRAM_POSITIVE | SignalP-TM | SignalP-TM |
| 1 | 36 | ProSitePatterns | PS00430 | TonB-dependent receptor proteins signature 1. |
| 1 | 36 | InterPro | IPR010916 | TonB box, conserved site |
| 714 | 731 | ProSitePatterns | PS01156 | TonB-dependent receptor proteins signature 2. |
| 714 | 731 | InterPro | IPR010917 | TonB-dependent receptor, conserved site |
| 158 | 731 | FunFam | G3DSA:2.40.170.20:FF:000007 | Ferric aerobactin receptor |
| 43 | 144 | Pfam | PF07715 | TonB-dependent Receptor Plug Domain |
| 43 | 144 | InterPro | IPR012910 | TonB-dependent receptor, plug domain |
| 29 | 731 | SUPERFAMILY | SSF56935 | Porins |
| 156 | 731 | Gene3D | G3DSA:2.40.170.20 | - |
| 156 | 731 | InterPro | IPR036942 | TonB-dependent receptor-like, beta-barrel domain superfamily |
| 16 | 727 | PANTHER | PTHR30069 | TONB-DEPENDENT OUTER MEMBRANE RECEPTOR |
| 16 | 727 | InterPro | IPR039426 | TonB-dependent receptor-like |
| 20 | 23 | Phobius | SIGNAL_PEPTIDE_C_REGION | C-terminal region of a signal peptide. |
| 44 | 731 | NCBIfam | TIGR01783 | TonB-dependent siderophore receptor |
| 44 | 731 | InterPro | IPR010105 | TonB-dependent siderophore receptor |
| 1 | 6 | Phobius | SIGNAL_PEPTIDE_N_REGION | N-terminal region of a signal peptide. |
| 24 | 731 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 240 | 727 | Pfam | PF00593 | TonB dependent receptor |
| 240 | 727 | InterPro | IPR000531 | TonB-dependent receptor-like, beta-barrel |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · FPocket
Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GLH7
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
VK055_1357
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural ligand evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| C8E RCSB PDB | P06129 | 306.4 Da LogP 2.41 TPSA 57.2 | ✓ Ro5 | ✓ Clean |
CCCCCCCCOCCOCCOCCOCCO
|
|
| DPO RCSB PDB | P06971 | 173.9 Da LogP -3.34 TPSA 135.6 | ✓ Ro5 | ✓ Clean |
[O-]P(=O)([O-])OP(=O)([O-])[O-]
|
|
| FTT RCSB PDB | P06971 | 244.4 Da LogP 3.74 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCC[C@H](CC(=O)O)O
|
|
| HEX RCSB PDB | P06129 | 86.2 Da LogP 2.59 TPSA 0.0 | ✓ Ro5 | ✓ Clean |
CCCCCC
|
|
| LDA RCSB PDB | P06129 | 229.4 Da LogP 4.48 TPSA 23.1 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCC[N+](C)(C)[O-]
|
|
| MPG RCSB PDB | P06129 | 356.5 Da LogP 4.92 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCC/C=C\CCCCCCCCOC(=O)[C@@H](CO)O
|
|
| MTN RCSB PDB | P06129 | 264.4 Da LogP 1.82 TPSA 57.3 | ✓ Ro5 | ✓ Clean |
CC1(C=C(C(N1[O])(C)C)CSS(=O)(=O)C)C
|
|
| OCT RCSB PDB | P06129 | 114.2 Da LogP 3.37 TPSA 0.0 | ✓ Ro5 | ✓ Clean |
CCCCCCCC
|
|
| OES RCSB PDB | P06971 | 206.4 Da LogP 2.09 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCC[S@@](=O)CCO
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC100107878 ZINC | 1.000 | 262.5 Da LogP 3.65 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCC[S@@](=O)CCO
|
| ZINC100107879 ZINC | 1.000 | 262.5 Da LogP 3.65 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCC[S@](=O)CCO
|
| ZINC14880335 ZINC | 1.000 | 206.4 Da LogP 2.09 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCC[S@@](=O)CCO
|
| ZINC14880337 ZINC | 1.000 | 206.4 Da LogP 2.09 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCC[S@](=O)CCO
|
| ZINC16051927 ZINC | 1.000 | 216.3 Da LogP 2.96 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
CCCCCCCCC[C@@H](O)CC(=O)O
|
| ZINC1849937 ZINC | 1.000 | 201.4 Da LogP 3.70 TPSA 23.1 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCC[N+](C)(C)[O-]
|
| ZINC2008702 ZINC | 1.000 | 243.4 Da LogP 4.87 TPSA 23.1 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCC[N+](C)(C)[O-]
|
| ZINC2039068 ZINC | 1.000 | 244.4 Da LogP 3.74 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCC[C@H](O)CC(=O)O
|
| ZINC2039069 ZINC | 1.000 | 244.4 Da LogP 3.74 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCC[C@@H](O)CC(=O)O
|
| ZINC2039372 ZINC | 1.000 | 229.4 Da LogP 4.48 TPSA 23.1 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCC[N+](C)(C)[O-]
|
| ZINC2504625 ZINC | 1.000 | 216.3 Da LogP 2.96 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
CCCCCCCCC[C@H](O)CC(=O)O
|
| ZINC2516963 ZINC | 1.000 | 215.4 Da LogP 4.09 TPSA 23.1 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCC[N+](C)(C)[O-]
|
| ZINC2558055 ZINC | 1.000 | 202.3 Da LogP 2.57 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
CCCCCCCC[C@H](O)CC(=O)O
|
| ZINC33354303 ZINC | 1.000 | 234.4 Da LogP 2.87 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCC[S@@](=O)CCO
|
| ZINC33354306 ZINC | 1.000 | 234.4 Da LogP 2.87 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCC[S@](=O)CCO
|
| ZINC58631420 ZINC | 1.000 | 422.6 Da LogP 3.22 TPSA 75.6 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCOCCOCCOCCOCCOCCOCCO
|
| ZINC85915165 ZINC | 1.000 | 202.3 Da LogP 2.57 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
CCCCCCCC[C@@H](O)CC(=O)O
|
| ZINC100244447 ZINC | 0.826 | 276.5 Da LogP 4.04 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCC[S@@](=O)CCCCCCCO
|
| ZINC100244449 ZINC | 0.826 | 276.5 Da LogP 4.04 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCC[S@](=O)CCCCCCCO
|
| ZINC98008410 ZINC | 0.826 | 220.4 Da LogP 2.48 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCC[S@@](=O)CCCO
|
| ZINC98008411 ZINC | 0.826 | 220.4 Da LogP 2.48 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCC[S@](=O)CCCO
|
| ZINC98008413 ZINC | 0.826 | 234.4 Da LogP 2.87 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCC[S@@](=O)CCCCO
|
| ZINC98008414 ZINC | 0.826 | 234.4 Da LogP 2.87 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCC[S@](=O)CCCCO
|
| ZINC31159540 ZINC | 0.778 | 204.3 Da LogP 1.15 TPSA 77.8 | ✓ Ro5 | ✓ Clean |
CCCCC[C@@H](O)C[C@@H](O)CC(=O)O
|
| ZINC31159544 ZINC | 0.778 | 204.3 Da LogP 1.15 TPSA 77.8 | ✓ Ro5 | ✓ Clean |
CCCCC[C@H](O)C[C@@H](O)CC(=O)O
|
| ZINC31159548 ZINC | 0.778 | 204.3 Da LogP 1.15 TPSA 77.8 | ✓ Ro5 | ✓ Clean |
CCCCC[C@@H](O)C[C@H](O)CC(=O)O
|
| ZINC31159552 ZINC | 0.778 | 204.3 Da LogP 1.15 TPSA 77.8 | ✓ Ro5 | ✓ Clean |
CCCCC[C@H](O)C[C@H](O)CC(=O)O
|
| ZINC1593347 ZINC | 0.762 | 246.5 Da LogP 4.68 TPSA 17.1 | ✓ Ro5 | ✓ Clean |
CCCCCCCS(=O)CCCCCCC
|
| ZINC12493601 ZINC | 0.667 | 218.2 Da LogP 1.25 TPSA 94.8 | ✓ Ro5 | ✓ Clean |
O=C(O)CCCCCC[C@H](O)CC(=O)O
|
| ZINC12493608 ZINC | 0.667 | 218.2 Da LogP 1.25 TPSA 94.8 | ✓ Ro5 | ✓ Clean |
O=C(O)CCCCCC[C@@H](O)CC(=O)O
|
| ZINC12493811 ZINC | 0.667 | 274.4 Da LogP 2.81 TPSA 94.8 | ✓ Ro5 | ✓ Clean |
O=C(O)CCCCCCCCCC[C@H](O)CC(=O)O
|
| ZINC12493817 ZINC | 0.667 | 274.4 Da LogP 2.81 TPSA 94.8 | ✓ Ro5 | ✓ Clean |
O=C(O)CCCCCCCCCC[C@@H](O)CC(=O)O
|
| ZINC201728946 ZINC | 0.667 | 330.5 Da LogP 4.06 TPSA 83.8 | ✓ Ro5 | ✓ Clean |
CCCCCCC[C@H](O)CC(=O)O[C@@H](CCCCC)CC(=O)O
|
| ZINC201728978 ZINC | 0.667 | 330.5 Da LogP 4.06 TPSA 83.8 | ✓ Ro5 | ✓ Clean |
CCCCCCC[C@@H](O)CC(=O)O[C@@H](CCCCC)CC(=O)O
|
| ZINC201729010 ZINC | 0.667 | 330.5 Da LogP 4.06 TPSA 83.8 | ✓ Ro5 | ✓ Clean |
CCCCCCC[C@H](O)CC(=O)O[C@H](CCCCC)CC(=O)O
|
| ZINC201729040 ZINC | 0.667 | 330.5 Da LogP 4.06 TPSA 83.8 | ✓ Ro5 | ✓ Clean |
CCCCCCC[C@@H](O)CC(=O)O[C@H](CCCCC)CC(=O)O
|
| ZINC87527743 ZINC | 0.667 | 358.5 Da LogP 4.84 TPSA 83.8 | ✓ Ro5 | ✓ Clean |
CCCCCCC[C@H](O)CC(=O)O[C@@H](CCCCCCC)CC(=O)O
|
| ZINC87527746 ZINC | 0.667 | 358.5 Da LogP 4.84 TPSA 83.8 | ✓ Ro5 | ✓ Clean |
CCCCCCC[C@@H](CC(=O)O)OC(=O)C[C@H](O)CCCCCCC
|
| ZINC87527749 ZINC | 0.667 | 358.5 Da LogP 4.84 TPSA 83.8 | ✓ Ro5 | ✓ Clean |
CCCCCCC[C@H](O)CC(=O)O[C@H](CCCCCCC)CC(=O)O
|
| ZINC87527752 ZINC | 0.667 | 358.5 Da LogP 4.84 TPSA 83.8 | ✓ Ro5 | ✓ Clean |
CCCCCCC[C@@H](O)CC(=O)O[C@H](CCCCCCC)CC(=O)O
|
| ZINC137430827 ZINC | 0.656 | 329.5 Da LogP 3.64 TPSA 86.6 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCC[C@H](O)CC(=O)NCC(=O)O
|
| ZINC137430904 ZINC | 0.656 | 329.5 Da LogP 3.64 TPSA 86.6 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCC[C@@H](O)CC(=O)NCC(=O)O
|
| ZINC2530733 ZINC | 0.643 | 200.3 Da LogP 3.85 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCC[C@H](C)CC(=O)O
|
| ZINC2578907 ZINC | 0.643 | 214.3 Da LogP 4.24 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCCC[C@H](C)CC(=O)O
|
| ZINC59297041 ZINC | 0.643 | 200.3 Da LogP 3.85 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCC[C@@H](C)CC(=O)O
|
| ZINC59658579 ZINC | 0.643 | 214.3 Da LogP 4.24 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCCC[C@@H](C)CC(=O)O
|
| ZINC216292330 ZINC | 0.636 | 302.4 Da LogP 3.28 TPSA 83.8 | ✓ Ro5 | ✓ Clean |
CCCCC[C@@H](CC(=O)O)OC(=O)C[C@H](O)CCCCC
|
| ZINC216292417 ZINC | 0.636 | 302.4 Da LogP 3.28 TPSA 83.8 | ✓ Ro5 | ✓ Clean |
CCCCC[C@@H](O)CC(=O)O[C@H](CCCCC)CC(=O)O
|
| ZINC95933636 ZINC | 0.636 | 228.3 Da LogP -1.14 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
O=[S@@](CCO)CCC[S@](=O)CCO
|
| ZINC95933637 ZINC | 0.636 | 228.3 Da LogP -1.14 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
O=[S@](CCO)CCC[S@](=O)CCO
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.