Protein target profile
VK055_1374
3-oxoacyl-[acyl-carrier-protein] reductase
Strong target candidate with converging metabolic, structural and chemical evidence.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Evidence coverage
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- Hit
- Human identity (%)
- 65.625 Lower values reduce human off-target concern.
- Human E-value
- 2.44e-06
- Gut microbiome similarity
- 20.2% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- Y
- DEG identity (%)
- 95.082 Higher values support similarity to known essential genes.
- DEG E-value
- 3.1600000000000007e-167 Smaller values mean stronger essential-gene similarity.
Localization
- Localization
- Cytoplasmic
Structure confidence
- ColabFold pLDDT
- 97.41 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
PDB experimental structureThe selected pocket score is the FPocket value used for ranking after applying the curated structure priority. It estimates small-molecule pocket quality; it is not experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.
Sequence
Structure
Pathways
Sequence
Primary amino-acid sequence viewer.
MSFEGKIALVTGASRGIGRAIAETLVARGAKVIGTATSESGAQAISDYLGANGKGLMLNVTDPASIESVLENVRAEFGEVDILVNNAGITRDNLLMRMKDDEWNDIIETNLSSVFRLSKAVMRAMMKKRHGRIITIGSVVGTMGNAGQANYAAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETDMTRALTDEQRAGTLAAVPAGRLGTPNEIASAVAFLASDEASYITGETLHVNGGMYMV
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Enzyme Commission (EC)
1Gene Ontology (GO)
5- GO:0006633 The chemical reactions and pathways resulting in the formation of a fatty acid, any of the aliphatic monocarboxylic acids that can be liberated by hydrolysis from naturally occurring fats and oils. Fatty acids are predominantly straight-chain acids of 4 to 24 carbon atoms, which may be saturated or unsaturated; branched fatty acids and hydroxy fatty acids also occur, and very long chain acids of over 30 carbons are found in waxes.
- GO:0051287 Binding to nicotinamide adenine dinucleotide, a coenzyme involved in many redox and biosynthetic reactions; binding may be to either the oxidized form, NAD+, or the reduced form, NADH.
- GO:0016491 Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
- GO:0004316 Catalysis of the reaction: (3R)-3-hydroxyacyl-[acyl-carrier protein] + NADP+ = 3-oxoacyl-[acyl-carrier protein] + NADPH + H+.
- GO:0030497 The elongation of a fatty acid chain by the sequential addition of two-carbon units.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 1 | 244 | Gene3D | G3DSA:3.40.50.720 | - |
| 131 | 139 | PRINTS | PR00080 | Short-chain dehydrogenase/reductase (SDR) superfamily signature |
| 131 | 139 | InterPro | IPR002347 | Short-chain dehydrogenase/reductase SDR |
| 151 | 170 | PRINTS | PR00080 | Short-chain dehydrogenase/reductase (SDR) superfamily signature |
| 151 | 170 | InterPro | IPR002347 | Short-chain dehydrogenase/reductase SDR |
| 78 | 89 | PRINTS | PR00080 | Short-chain dehydrogenase/reductase (SDR) superfamily signature |
| 78 | 89 | InterPro | IPR002347 | Short-chain dehydrogenase/reductase SDR |
| 6 | 187 | SMART | SM00822 | This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain. It uses NADPH to reduce the keto group to a hydroxy group. |
| 1 | 244 | FunFam | G3DSA:3.40.50.720:FF:000037 | 3-oxoacyl-[acyl-carrier-protein] reductase FabG |
| 8 | 242 | NCBIfam | TIGR01830 | 3-oxoacyl-[acyl-carrier-protein] reductase |
| 8 | 242 | InterPro | IPR011284 | 3-oxoacyl-(acyl-carrier-protein) reductase |
| 2 | 242 | PANTHER | PTHR42879 | 3-OXOACYL-(ACYL-CARRIER-PROTEIN) REDUCTASE |
| 6 | 242 | CDD | cd05333 | BKR_SDR_c |
| 138 | 166 | ProSitePatterns | PS00061 | Short-chain dehydrogenases/reductases family signature. |
| 138 | 166 | InterPro | IPR020904 | Short-chain dehydrogenase/reductase, conserved site |
| 125 | 141 | PRINTS | PR00081 | Glucose/ribitol dehydrogenase family signature |
| 125 | 141 | InterPro | IPR002347 | Short-chain dehydrogenase/reductase SDR |
| 151 | 170 | PRINTS | PR00081 | Glucose/ribitol dehydrogenase family signature |
| 205 | 225 | PRINTS | PR00081 | Glucose/ribitol dehydrogenase family signature |
| 205 | 225 | InterPro | IPR002347 | Short-chain dehydrogenase/reductase SDR |
| 172 | 189 | PRINTS | PR00081 | Glucose/ribitol dehydrogenase family signature |
| 172 | 189 | InterPro | IPR002347 | Short-chain dehydrogenase/reductase SDR |
| 7 | 24 | PRINTS | PR00081 | Glucose/ribitol dehydrogenase family signature |
| 7 | 24 | InterPro | IPR002347 | Short-chain dehydrogenase/reductase SDR |
| 78 | 89 | PRINTS | PR00081 | Glucose/ribitol dehydrogenase family signature |
| 12 | 241 | Pfam | PF13561 | Enoyl-(Acyl carrier protein) reductase |
| 4 | 243 | SUPERFAMILY | SSF51735 | NAD(P)-binding Rossmann-fold domains |
| 4 | 243 | InterPro | IPR036291 | NAD(P)-binding domain superfamily |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · FPocket
Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · P2Rank
Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Residue sets
All structural evidence
Structural evidence
1 + 1Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural and bioactivity evidence are both available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| 34X RCSB PDB | O54438 | 311.3 Da LogP 3.05 TPSA 85.0 | ✓ Ro5 | ✓ Clean |
c1ccc(cc1)c2cn(c(n2)N)NC(=O)Nc3ccccc3F
|
|
| 36E RCSB PDB | O54438 | 186.1 Da LogP 2.58 TPSA 28.7 | ✓ Ro5 | ✓ Clean |
c1ccc2c(c1)[nH]c(n2)C(F)(F)F
|
|
| 36G RCSB PDB | O54438 | 282.3 Da LogP 3.68 TPSA 41.6 | ✓ Ro5 | ✓ Clean |
COc1ccccc1NC(=O)N2CCCc3c2cccc3
|
|
| 36I RCSB PDB | O54438 | 297.4 Da LogP 3.19 TPSA 38.2 | ✓ Ro5 | ✓ Clean |
c1ccc(cc1)c2nc3ccsc3c(n2)N4CCOCC4
|
|
| 36K RCSB PDB | O54438 | 310.4 Da LogP 3.71 TPSA 68.2 | ✓ Ro5 | ✓ Clean |
CCn1c2ccccc2nc1NC(=O)Nc3ccccc3OC
|
|
| 36P RCSB PDB | O54438 | 312.4 Da LogP 4.07 TPSA 33.2 | ✓ Ro5 | ✓ Clean |
c1ccc2c(c1)CCN2C(=O)c3csc(n3)c4ccsc4
|
|
| 3X3 RCSB PDB | O54438 | 318.3 Da LogP 3.50 TPSA 66.0 | ✓ Ro5 | ✓ Clean |
c1ccc(cc1)n2nc(nn2)c3ccccc3OCc4ccco4
|
|
| 8M5 RCSB PDB | O54438 | 250.3 Da LogP 3.43 TPSA 34.0 | ✓ Ro5 | ✓ Clean |
Cn1cc(c2c1cccc2)C(=O)Nc3ccccc3
|
|
| 9KQ RCSB PDB | O54438 | 273.3 Da LogP 2.88 TPSA 56.5 | ✓ Ro5 | ✓ Clean |
c1ccc(cc1)c2nc3ccccc3c(n2)n4cnnc4
|
|
| FXE RCSB PDB | O54438 | 326.4 Da LogP 3.23 TPSA 77.4 | ✓ Ro5 | ✓ Clean |
Cn1c2cccc(c2c(n1)NC(=O)Nc3ccccc3OC)OC
|
|
| J2T RCSB PDB | O54438 | 252.3 Da LogP 1.75 TPSA 68.0 | ✓ Ro5 | ✓ Clean |
c1cc2c(cc1Nc3ccc4nnnn4n3)CCC2
|
|
| MLH RCSB PDB | V5VHN7 | 417.3 Da LogP 4.34 TPSA 54.7 | ✓ Ro5 | ✓ Clean |
CCOC(=O)c1c2cc(c(cc2n(c1CN(C)C)c3ccccc3)Br)O
|
|
| NKH RCSB PDB | O54438 | 342.8 Da LogP 4.16 TPSA 60.5 | ✓ Ro5 | ✓ Clean |
COc1cc(c(cc1Cl)OC)NC(=O)c2cccc3c2nccc3
|
|
| O74 RCSB PDB | O54438 | 347.8 Da LogP 4.53 TPSA 53.5 | ✓ Ro5 | ✓ Clean |
c1ccc2c(c1)C(=N/C(=C/3\C=CC=CC3=O)/N2)Nc4ccccc4…
|
|
| P4C RCSB PDB | Q3JRS9 | 324.4 Da LogP -0.72 TPSA 92.7 | ✓ Ro5 | ✓ Clean |
C(COCCOCCOCCOCCOCCOCC=O)O
|
|
| Q7U RCSB PDB | O54438 | 300.7 Da LogP 3.87 TPSA 59.0 | ✓ Ro5 | ✓ Clean |
Cn1c2ccccc2nc1NC(=O)Nc3ccccc3Cl
|
|
| U98 RCSB PDB | O54438 | 317.3 Da LogP 2.49 TPSA 85.1 | ✓ Ro5 | ✓ Clean |
c1cc(cc(c1)Nc2c(cccn2)S(=O)(=O)N)C(F)(F)F
|
|
| WI4 RCSB PDB | O54438 | 271.7 Da LogP 3.06 TPSA 55.6 | ✓ Ro5 | ✓ Clean |
c1ccc(c(c1)Nc2ncnc(n2)n3cccc3)Cl
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
| Ligand | UniProt (homolog) | pchembl | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| KDH ChEMBL | Q965D6 | 6.52 ~302.0 nM | 458.4 Da LogP 2.23 TPSA 197.4 | 2 viol. | Alert |
c1c(cc(c(c1O)O)O)[C@@H]2[C@@H](Cc3c(cc(cc3O2)O)…
|
| LU2 ChEMBL | Q965D6 | 6.10 ~794.3 nM | 286.2 Da LogP 2.28 TPSA 111.1 | ✓ Ro5 | Alert |
c1cc(c(cc1C2=CC(=O)c3c(cc(cc3O2)O)O)O)O
|
| CHEMBL129451 ChEMBL | Q965D6 | 6.00 ~1.0 µM | 442.4 Da LogP 2.53 TPSA 177.1 | 1 viol. | Alert |
O=C(O[C@@H]1Cc2c(O)cc(O)cc2O[C@H]1c1ccc(O)c(O)c…
|
| CHEMBL36327 ChEMBL | Q965D6 | 6.00 ~1.0 µM | 442.4 Da LogP 2.53 TPSA 177.1 | 1 viol. | Alert |
O=C(O[C@@H]1Cc2c(O)cc(O)cc2O[C@@H]1c1ccc(O)c(O)…
|
| NAR ChEMBL | Q965D6 | — | 272.3 Da LogP 2.51 TPSA 87.0 | ✓ Ro5 | ✓ Clean |
c1cc(ccc1[C@@H]2CC(=O)c3c(cc(cc3O2)O)O)O
|
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC1233995 ZINC | 1.000 | 417.3 Da LogP 4.34 TPSA 54.7 | ✓ Ro5 | ✓ Clean |
CCOC(=O)c1c(CN(C)C)n(-c2ccccc2)c2cc(Br)c(O)cc12
|
| ZINC13152723 ZINC | 1.000 | 310.4 Da LogP 3.71 TPSA 68.2 | ✓ Ro5 | ✓ Clean |
CCn1c(NC(=O)Nc2ccccc2OC)nc2ccccc21
|
| ZINC1399281 ZINC | 1.000 | 297.4 Da LogP 3.19 TPSA 38.2 | ✓ Ro5 | ✓ Clean |
c1ccc(-c2nc(N3CCOCC3)c3sccc3n2)cc1
|
| ZINC18185774 ZINC | 1.000 | 286.2 Da LogP 2.28 TPSA 111.1 | ✓ Ro5 | Alert |
O=c1cc(-c2ccc(O)c(O)c2)oc2cc(O)cc(O)c12
|
| ZINC27923853 ZINC | 1.000 | 300.7 Da LogP 3.87 TPSA 59.0 | ✓ Ro5 | ✓ Clean |
Cn1c(NC(=O)Nc2ccccc2Cl)nc2ccccc21
|
| ZINC318945 ZINC | 1.000 | 282.3 Da LogP 3.68 TPSA 41.6 | ✓ Ro5 | ✓ Clean |
COc1ccccc1NC(=O)N1CCCc2ccccc21
|
| ZINC3870412 ZINC | 1.000 | 458.4 Da LogP 2.23 TPSA 197.4 | 2 viol. | Alert |
O=C(O[C@@H]1Cc2c(O)cc(O)cc2O[C@@H]1c1cc(O)c(O)c…
|
| ZINC3870413 ZINC | 1.000 | 458.4 Da LogP 2.23 TPSA 197.4 | 2 viol. | Alert |
O=C(O[C@@H]1Cc2c(O)cc(O)cc2O[C@H]1c1cc(O)c(O)c(…
|
| ZINC3870414 ZINC | 1.000 | 458.4 Da LogP 2.23 TPSA 197.4 | 2 viol. | Alert |
O=C(O[C@H]1Cc2c(O)cc(O)cc2O[C@@H]1c1cc(O)c(O)c(…
|
| ZINC3870415 ZINC | 1.000 | 458.4 Da LogP 2.23 TPSA 197.4 | 2 viol. | Alert |
O=C(O[C@H]1Cc2c(O)cc(O)cc2O[C@H]1c1cc(O)c(O)c(O…
|
| ZINC481463 ZINC | 1.000 | 317.3 Da LogP 2.49 TPSA 85.1 | ✓ Ro5 | ✓ Clean |
NS(=O)(=O)c1cccnc1Nc1cccc(C(F)(F)F)c1
|
| ZINC7913991 ZINC | 1.000 | 250.3 Da LogP 3.43 TPSA 34.0 | ✓ Ro5 | ✓ Clean |
Cn1cc(C(=O)Nc2ccccc2)c2ccccc21
|
| ZINC8231765 ZINC | 1.000 | 342.8 Da LogP 4.16 TPSA 60.5 | ✓ Ro5 | ✓ Clean |
COc1cc(NC(=O)c2cccc3cccnc23)c(OC)cc1Cl
|
| ZINC8429509 ZINC | 1.000 | 312.4 Da LogP 4.07 TPSA 33.2 | ✓ Ro5 | ✓ Clean |
O=C(c1csc(-c2ccsc2)n1)N1CCc2ccccc21
|
| ZINC8723457 ZINC | 1.000 | 252.3 Da LogP 1.75 TPSA 68.0 | ✓ Ro5 | ✓ Clean |
c1cc2c(cc1Nc1ccc3nnnn3n1)CCC2
|
| ZINC8726387 ZINC | 1.000 | 273.3 Da LogP 2.88 TPSA 56.5 | ✓ Ro5 | ✓ Clean |
c1ccc(-c2nc(-n3cnnc3)c3ccccc3n2)cc1
|
| ZINC89647 ZINC | 1.000 | 271.7 Da LogP 3.06 TPSA 55.6 | ✓ Ro5 | ✓ Clean |
Clc1ccccc1Nc1ncnc(-n2cccc2)n1
|
| ZINC9338279 ZINC | 1.000 | 311.3 Da LogP 3.05 TPSA 85.0 | ✓ Ro5 | ✓ Clean |
Nc1nc(-c2ccccc2)cn1NC(=O)Nc1ccccc1F
|
| ZINC451821 ZINC | 0.857 | 268.3 Da LogP 3.29 TPSA 41.6 | ✓ Ro5 | ✓ Clean |
COc1ccccc1NC(=O)N1CCc2ccccc21
|
| ZINC14436185 ZINC | 0.854 | 472.4 Da LogP 2.54 TPSA 186.4 | 2 viol. | Alert |
COc1cc(C(=O)O[C@@H]2Cc3c(O)cc(O)cc3O[C@@H]2c2cc…
|
| ZINC3978503 ZINC | 0.851 | 442.4 Da LogP 2.53 TPSA 177.1 | 1 viol. | Alert |
O=C(O[C@@H]1Cc2c(O)cc(O)cc2O[C@@H]1c1ccc(O)c(O)…
|
| ZINC4534390 ZINC | 0.851 | 442.4 Da LogP 2.53 TPSA 177.1 | 1 viol. | Alert |
O=C(O[C@H]1Cc2c(O)cc(O)cc2O[C@@H]1c1ccc(O)c(O)c…
|
| ZINC4544252 ZINC | 0.851 | 442.4 Da LogP 2.53 TPSA 177.1 | 1 viol. | Alert |
O=C(O[C@H]1Cc2c(O)cc(O)cc2O[C@H]1c1ccc(O)c(O)c1…
|
| ZINC8681494 ZINC | 0.851 | 442.4 Da LogP 2.53 TPSA 177.1 | 1 viol. | Alert |
O=C(O[C@@H]1Cc2c(O)cc(O)cc2O[C@H]1c1ccc(O)c(O)c…
|
| ZINC8453886 ZINC | 0.849 | 431.3 Da LogP 4.65 TPSA 54.7 | ✓ Ro5 | ✓ Clean |
CCOC(=O)c1c(CN(C)C)n(-c2ccc(C)cc2)c2cc(Br)c(O)c…
|
| ZINC14727965 ZINC | 0.848 | 426.4 Da LogP 2.82 TPSA 156.9 | 1 viol. | Alert |
O=C(O[C@@H]1Cc2c(O)cc(O)cc2O[C@@H]1c1ccc(O)cc1)…
|
| ZINC12534489 ZINC | 0.833 | 307.4 Da LogP 3.39 TPSA 63.1 | ✓ Ro5 | ✓ Clean |
CC(=O)Nc1ccc(NC(=O)c2cn(C)c3ccccc23)cc1
|
| ZINC27923895 ZINC | 0.833 | 335.2 Da LogP 4.52 TPSA 59.0 | ✓ Ro5 | ✓ Clean |
Cn1c(NC(=O)Nc2cccc(Cl)c2Cl)nc2ccccc21
|
| ZINC7917230 ZINC | 0.833 | 264.3 Da LogP 3.74 TPSA 34.0 | ✓ Ro5 | ✓ Clean |
Cc1ccc(NC(=O)c2cn(C)c3ccccc23)cc1
|
| ZINC32497089 ZINC | 0.811 | 278.3 Da LogP 2.79 TPSA 51.1 | ✓ Ro5 | ✓ Clean |
Cn1cc(C(=O)Nc2ccccc2)c(=O)c2ccccc21
|
| ZINC27923339 ZINC | 0.800 | 340.4 Da LogP 3.72 TPSA 77.4 | ✓ Ro5 | ✓ Clean |
CCn1c(NC(=O)Nc2cc(OC)ccc2OC)nc2ccccc21
|
| ZINC5222178 ZINC | 0.800 | 431.3 Da LogP 4.64 TPSA 43.7 | ✓ Ro5 | ✓ Clean |
CCOC(=O)c1c(CN(C)C)n(-c2ccccc2)c2cc(Br)c(OC)cc12
|
| ZINC95453238 ZINC | 0.800 | 360.8 Da LogP 4.30 TPSA 60.5 | ✓ Ro5 | ✓ Clean |
COc1cc(NC(=O)c2cc(F)cc3cccnc23)c(OC)cc1Cl
|
| ZINC8074404 ZINC | 0.795 | 293.3 Da LogP 2.53 TPSA 77.1 | ✓ Ro5 | ✓ Clean |
Cn1cc(C(=O)Nc2ccc(C(N)=O)cc2)c2ccccc21
|
| ZINC32726013 ZINC | 0.789 | 251.3 Da LogP 2.83 TPSA 46.9 | ✓ Ro5 | ✓ Clean |
Cn1cc(C(=O)Nc2ccncc2)c2ccccc21
|
| ZINC15934558 ZINC | 0.787 | 312.4 Da LogP 3.69 TPSA 50.8 | ✓ Ro5 | ✓ Clean |
COc1ccc(OC)c(NC(=O)N2CCCc3ccccc32)c1
|
| ZINC15934559 ZINC | 0.787 | 312.4 Da LogP 3.69 TPSA 50.8 | ✓ Ro5 | ✓ Clean |
COc1ccc(NC(=O)N2CCCc3ccccc32)c(OC)c1
|
| ZINC27923428 ZINC | 0.784 | 344.8 Da LogP 4.36 TPSA 68.2 | ✓ Ro5 | ✓ Clean |
CCn1c(NC(=O)Nc2cc(Cl)ccc2OC)nc2ccccc21
|
| ZINC5875060 ZINC | 0.780 | 281.4 Da LogP 3.96 TPSA 29.0 | ✓ Ro5 | ✓ Clean |
c1ccc(-c2nc(N3CCCC3)c3sccc3n2)cc1
|
| ZINC3871576 ZINC | 0.778 | 270.2 Da LogP 2.58 TPSA 90.9 | ✓ Ro5 | ✓ Clean |
O=c1cc(-c2ccc(O)cc2)oc2cc(O)cc(O)c12
|
| ZINC4348965 ZINC | 0.775 | 270.3 Da LogP 3.11 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
Cc1cc(O)c2c(c1)O[C@H](c1ccc(O)cc1)CC2=O
|
| ZINC4348970 ZINC | 0.775 | 270.3 Da LogP 3.11 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
Cc1cc(O)c2c(c1)O[C@@H](c1ccc(O)cc1)CC2=O
|
| ZINC2027558 ZINC | 0.773 | 318.3 Da LogP 3.09 TPSA 79.3 | ✓ Ro5 | ✓ Clean |
O=S(=O)(O)c1cccnc1Nc1cccc(C(F)(F)F)c1
|
| ZINC16552269 ZINC | 0.771 | 296.4 Da LogP 3.99 TPSA 41.6 | ✓ Ro5 | ✓ Clean |
COc1ccccc1NC(=O)N1CCCc2cc(C)ccc21
|
| ZINC6726962 ZINC | 0.771 | 296.4 Da LogP 3.99 TPSA 41.6 | ✓ Ro5 | ✓ Clean |
COc1ccc(C)cc1NC(=O)N1CCCc2ccccc21
|
| ZINC12515506 ZINC | 0.769 | 307.4 Da LogP 3.39 TPSA 63.1 | ✓ Ro5 | ✓ Clean |
CC(=O)Nc1cccc(NC(=O)c2cn(C)c3ccccc23)c1
|
| ZINC15934557 ZINC | 0.766 | 296.4 Da LogP 4.07 TPSA 41.6 | ✓ Ro5 | ✓ Clean |
CCOc1ccccc1NC(=O)N1CCCc2ccccc21
|
| ZINC5903093 ZINC | 0.762 | 309.4 Da LogP 4.74 TPSA 29.0 | ✓ Ro5 | ✓ Clean |
c1ccc(-c2nc(N3CCCCCC3)c3sccc3n2)cc1
|
| ZINC27646798 ZINC | 0.761 | 313.4 Da LogP 2.90 TPSA 58.5 | ✓ Ro5 | ✓ Clean |
Oc1cccc(-c2nc(N3CCOCC3)c3sccc3n2)c1
|
| ZINC21992201 ZINC | 0.760 | 458.4 Da LogP 2.23 TPSA 197.4 | 2 viol. | Alert |
O=C(O[C@H]1Cc2c(O)cc(O)cc2O[C@H]1c1cc(O)c(O)c(O…
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.