Protein target profile

VK055_1374

3-oxoacyl-[acyl-carrier-protein] reductase

Genome: KpATCC43816 Gene: fabG AIK79997.1 3D evidence: Experimental + ColabFold model Metabolism 10 reactions UniProt W9B6I8
Length 244
Pocket druggability 0.42
Metabolic reactions 10
Chokepoint Yes
Direct ligand evidence 0 73 total records
Functional annotation 1 EC 5 GO
Target summary

Strong target candidate with converging metabolic, structural and chemical evidence.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
65.625 Lower values reduce human off-target concern.
Human E-value
2.44e-06
Gut microbiome similarity
20.2% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
95.082 Higher values support similarity to known essential genes.
DEG E-value
3.1600000000000007e-167 Smaller values mean stronger essential-gene similarity.

Localization

Localization
Cytoplasmic

Structure confidence

ColabFold pLDDT
97.41 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

PDB experimental structure

The selected pocket score is the FPocket value used for ranking after applying the curated structure priority. It estimates small-molecule pocket quality; it is not experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

FPocket 0.42
Structure 6T77
Pocket Pocket 11
P2Rank 0.502
Structure 6T77
Pocket Pocket 1
ColabFold model
FPocket 0.177 · Pocket 8
P2Rank 0.668 · Pocket 1
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 957 / 4744 genomes with a hit
Prevalence 20.2%

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Structure

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

Explore metabolic network

Attractive metabolic target: catalyzes a producing & consuming chokepoint reaction, more central than 90.8% of genes in this genome.

Relative network centrality 90.8% more central than 90.8% of genes in this genome
Chokepoint Chokepoint gene
Pathways

No specific KEGG pathway assigned - this reaction either has no KEGG mapping, or only matches a generic overview map with no route-level information.

Catalyzed reactions

10 reactions mapped to this gene in the metabolic model. Open the full network to see each one, with substrates/products and the reaction-reaction map.

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MSFEGKIALVTGASRGIGRAIAETLVARGAKVIGTATSESGAQAISDYLGANGKGLMLNVTDPASIESVLENVRAEFGEVDILVNNAGITRDNLLMRMKDDEWNDIIETNLSSVFRLSKAVMRAMMKKRHGRIITIGSVVGTMGNAGQANYAAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETDMTRALTDEQRAGTLAAVPAGRLGTPNEIASAVAFLASDEASYITGETLHVNGGMYMV

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 5 GO

Enzyme Commission (EC)

1

Gene Ontology (GO)

5
  • GO:0006633 The chemical reactions and pathways resulting in the formation of a fatty acid, any of the aliphatic monocarboxylic acids that can be liberated by hydrolysis from naturally occurring fats and oils. Fatty acids are predominantly straight-chain acids of 4 to 24 carbon atoms, which may be saturated or unsaturated; branched fatty acids and hydroxy fatty acids also occur, and very long chain acids of over 30 carbons are found in waxes.
  • GO:0051287 Binding to nicotinamide adenine dinucleotide, a coenzyme involved in many redox and biosynthetic reactions; binding may be to either the oxidized form, NAD+, or the reduced form, NADH.
  • GO:0016491 Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
  • GO:0004316 Catalysis of the reaction: (3R)-3-hydroxyacyl-[acyl-carrier protein] + NADP+ = 3-oxoacyl-[acyl-carrier protein] + NADPH + H+.
  • GO:0030497 The elongation of a fatty acid chain by the sequential addition of two-carbon units.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

28 records
Show feature table
Start End DB Term Name
1 244 Gene3D G3DSA:3.40.50.720 -
131 139 PRINTS PR00080 Short-chain dehydrogenase/reductase (SDR) superfamily signature
131 139 InterPro IPR002347 Short-chain dehydrogenase/reductase SDR
151 170 PRINTS PR00080 Short-chain dehydrogenase/reductase (SDR) superfamily signature
151 170 InterPro IPR002347 Short-chain dehydrogenase/reductase SDR
78 89 PRINTS PR00080 Short-chain dehydrogenase/reductase (SDR) superfamily signature
78 89 InterPro IPR002347 Short-chain dehydrogenase/reductase SDR
6 187 SMART SM00822 This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain. It uses NADPH to reduce the keto group to a hydroxy group.
1 244 FunFam G3DSA:3.40.50.720:FF:000037 3-oxoacyl-[acyl-carrier-protein] reductase FabG
8 242 NCBIfam TIGR01830 3-oxoacyl-[acyl-carrier-protein] reductase
8 242 InterPro IPR011284 3-oxoacyl-(acyl-carrier-protein) reductase
2 242 PANTHER PTHR42879 3-OXOACYL-(ACYL-CARRIER-PROTEIN) REDUCTASE
6 242 CDD cd05333 BKR_SDR_c
138 166 ProSitePatterns PS00061 Short-chain dehydrogenases/reductases family signature.
138 166 InterPro IPR020904 Short-chain dehydrogenase/reductase, conserved site
125 141 PRINTS PR00081 Glucose/ribitol dehydrogenase family signature
125 141 InterPro IPR002347 Short-chain dehydrogenase/reductase SDR
151 170 PRINTS PR00081 Glucose/ribitol dehydrogenase family signature
205 225 PRINTS PR00081 Glucose/ribitol dehydrogenase family signature
205 225 InterPro IPR002347 Short-chain dehydrogenase/reductase SDR
172 189 PRINTS PR00081 Glucose/ribitol dehydrogenase family signature
172 189 InterPro IPR002347 Short-chain dehydrogenase/reductase SDR
7 24 PRINTS PR00081 Glucose/ribitol dehydrogenase family signature
7 24 InterPro IPR002347 Short-chain dehydrogenase/reductase SDR
78 89 PRINTS PR00081 Glucose/ribitol dehydrogenase family signature
12 241 Pfam PF13561 Enoyl-(Acyl carrier protein) reductase
4 243 SUPERFAMILY SSF51735 NAD(P)-binding Rossmann-fold domains
4 243 InterPro IPR036291 NAD(P)-binding domain superfamily

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · FPocket

Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Site 1 FPocket #11
0.42
Show in viewer
Surrounding area
Site 2 FPocket #2
0.308
Likely same site as P2Rank 1 3.5 Å 18 shared residues 82% of smaller site
Show in viewer
Surrounding area
Site 3 FPocket #6
0.204
Show in viewer
Surrounding area

Binding pockets · P2Rank

Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Site 1 P2Rank #1
0.502
Likely same site as FPocket 2 3.5 Å 18 shared residues 82% of smaller site
Show in viewer
Surrounding area
Site 2 P2Rank #2
0.108
Show in viewer
Surrounding area
All structural evidence 1 experimental · 1 predicted

Structural evidence

1 + 1

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
PDB 6T77
X-ray 1.75 Å A,B
100.0% 1-244
Viewing
ColabFold VK055_1374
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

73 records
Chemistry signal

Structural and bioactivity evidence are both available for this target.

Direct evidence 0 same-protein records
Transferred evidence 23 records from similar proteins
Structural ligands 18 0 loaded crystals
Measured bioactivity 5 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
34X PDB via homolog 311.3 Da · LogP 3.05 · TPSA 85.0 Open detail RCSB PDB
36E PDB via homolog Detail RCSB PDB
36G PDB via homolog Detail RCSB PDB
36I PDB via homolog Detail RCSB PDB
36K PDB via homolog Detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
34X RCSB PDB O54438 311.3 Da LogP 3.05 TPSA 85.0 ✓ Ro5 ✓ Clean c1ccc(cc1)c2cn(c(n2)N)NC(=O)Nc3ccccc3F
36E RCSB PDB O54438 186.1 Da LogP 2.58 TPSA 28.7 ✓ Ro5 ✓ Clean c1ccc2c(c1)[nH]c(n2)C(F)(F)F
36G RCSB PDB O54438 282.3 Da LogP 3.68 TPSA 41.6 ✓ Ro5 ✓ Clean COc1ccccc1NC(=O)N2CCCc3c2cccc3
36I RCSB PDB O54438 297.4 Da LogP 3.19 TPSA 38.2 ✓ Ro5 ✓ Clean c1ccc(cc1)c2nc3ccsc3c(n2)N4CCOCC4
36K RCSB PDB O54438 310.4 Da LogP 3.71 TPSA 68.2 ✓ Ro5 ✓ Clean CCn1c2ccccc2nc1NC(=O)Nc3ccccc3OC
36P RCSB PDB O54438 312.4 Da LogP 4.07 TPSA 33.2 ✓ Ro5 ✓ Clean c1ccc2c(c1)CCN2C(=O)c3csc(n3)c4ccsc4
3X3 RCSB PDB O54438 318.3 Da LogP 3.50 TPSA 66.0 ✓ Ro5 ✓ Clean c1ccc(cc1)n2nc(nn2)c3ccccc3OCc4ccco4
8M5 RCSB PDB O54438 250.3 Da LogP 3.43 TPSA 34.0 ✓ Ro5 ✓ Clean Cn1cc(c2c1cccc2)C(=O)Nc3ccccc3
9KQ RCSB PDB O54438 273.3 Da LogP 2.88 TPSA 56.5 ✓ Ro5 ✓ Clean c1ccc(cc1)c2nc3ccccc3c(n2)n4cnnc4
FXE RCSB PDB O54438 326.4 Da LogP 3.23 TPSA 77.4 ✓ Ro5 ✓ Clean Cn1c2cccc(c2c(n1)NC(=O)Nc3ccccc3OC)OC
J2T RCSB PDB O54438 252.3 Da LogP 1.75 TPSA 68.0 ✓ Ro5 ✓ Clean c1cc2c(cc1Nc3ccc4nnnn4n3)CCC2
MLH RCSB PDB V5VHN7 417.3 Da LogP 4.34 TPSA 54.7 ✓ Ro5 ✓ Clean CCOC(=O)c1c2cc(c(cc2n(c1CN(C)C)c3ccccc3)Br)O
NKH RCSB PDB O54438 342.8 Da LogP 4.16 TPSA 60.5 ✓ Ro5 ✓ Clean COc1cc(c(cc1Cl)OC)NC(=O)c2cccc3c2nccc3
O74 RCSB PDB O54438 347.8 Da LogP 4.53 TPSA 53.5 ✓ Ro5 ✓ Clean c1ccc2c(c1)C(=N/C(=C/3\C=CC=CC3=O)/N2)Nc4ccccc4…
P4C RCSB PDB Q3JRS9 324.4 Da LogP -0.72 TPSA 92.7 ✓ Ro5 ✓ Clean C(COCCOCCOCCOCCOCCOCC=O)O
Q7U RCSB PDB O54438 300.7 Da LogP 3.87 TPSA 59.0 ✓ Ro5 ✓ Clean Cn1c2ccccc2nc1NC(=O)Nc3ccccc3Cl
U98 RCSB PDB O54438 317.3 Da LogP 2.49 TPSA 85.1 ✓ Ro5 ✓ Clean c1cc(cc(c1)Nc2c(cccn2)S(=O)(=O)N)C(F)(F)F
WI4 RCSB PDB O54438 271.7 Da LogP 3.06 TPSA 55.6 ✓ Ro5 ✓ Clean c1ccc(c(c1)Nc2ncnc(n2)n3cccc3)Cl

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.