KpATCC43816 Protein target profile

beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabA

Accession: VK055_1504

Gene: AIK80124.1 fabA 3D evidence: AlphaFold DB model + ColabFold model Metabolism 10 reactions UniProt A0A0H3GL47
Length 172
Pocket druggability (P2Rank · AlphaFold DB model) 0.062
Metabolic reactions 10
Chokepoint Yes
Direct ligand evidence 0 63 total records
Functional annotation 2 EC 6 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
3.9% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
98.256 Higher values support similarity to known essential genes.
DEG E-value
5.33e-125 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
96.99 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.062
Structure A0A0H3GL47
Pocket Pocket 1
Druggability (FPocket) 0.288
Structure A0A0H3GL47
Pocket Pocket 5
ColabFold model
P2Rank 0.069 · Pocket 1
FPocket 0.345 · Pocket 5
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 186 / 4744 genomes with a hit
Prevalence 3.9%

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

Explore metabolic network

Attractive metabolic target: catalyzes a consuming chokepoint reaction, more central than 90.9% of genes in this genome, no human homolog detected.

Relative network centrality 90.9% more central than 90.9% of genes in this genome
Chokepoint Chokepoint gene
Pathways

No specific KEGG pathway assigned - this reaction either has no KEGG mapping, or only matches a generic overview map with no route-level information.

Catalyzed reactions

10 reactions mapped to this gene in the metabolic model. Open the full network to see each one, with substrates/products and the reaction-reaction map.

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MVDKRESYTKEDLLASGRGELFGAKGPQLPAPNMLMMDRVIKMTETGGNYDKGYVEAELDINPDLWFFGCHFIGDPVMPGCLGLDAMWQLVGFYLGWLGGEGKGRALGVGEVKFTGQVLPTAKKVTYRIHFKRIVNRRLIMGLADGEVLVDDRLIYTANDLKVGLFQDTSAF

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

2 EC 6 GO

Subcellular localization

Localization
Cytoplasmic

Enzyme Commission (EC)

2

Gene Ontology (GO)

6
  • GO:0006633 The chemical reactions and pathways resulting in the formation of a fatty acid, any of the aliphatic monocarboxylic acids that can be liberated by hydrolysis from naturally occurring fats and oils. Fatty acids are predominantly straight-chain acids of 4 to 24 carbon atoms, which may be saturated or unsaturated; branched fatty acids and hydroxy fatty acids also occur, and very long chain acids of over 30 carbons are found in waxes.
  • GO:0008693 OBSOLETE. Catalysis of the reaction: (3R)-3-hydroxydecanoyl-[acyl-carrier protein] = 2,3-decenoyl-[acyl-carrier protein] or 3,4-decenoyl-[acyl-carrier protein] + H2O.
  • GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
  • GO:0019171 Catalysis of the reaction: a (3R)-hydroxyacyl-[acyl-carrier-protein] = a (2E)-enoyl-[acyl-carrier-protein] + H2O.
  • GO:0034017 Catalysis of the reaction: trans-dec-2-enoyl-[acyl-carrier protein] = cis-dec-3-enoyl-[acyl-carrier protein].
  • GO:0006636 The chemical reactions and pathways resulting in the formation of an unsaturated fatty acid, any fatty acid containing one or more double bonds between carbon atoms.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

14 records
Show feature table
Start End DB Term Name
29 161 PANTHER PTHR30272 3-HYDROXYACYL-[ACYL-CARRIER-PROTEIN] DEHYDRATASE
29 161 InterPro IPR013114 Beta-hydroxydecanoyl thiol ester dehydrase, FabA/FabZ
1 172 FunFam G3DSA:3.10.129.10:FF:000003 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase
2 172 Hamap MF_00405 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase [fabA].
2 172 InterPro IPR010083 Beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabA
4 172 NCBIfam TIGR01749 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabA
4 172 InterPro IPR010083 Beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabA
29 158 Pfam PF07977 FabA-like domain
29 158 InterPro IPR013114 Beta-hydroxydecanoyl thiol ester dehydrase, FabA/FabZ
27 168 CDD cd01287 FabA
27 168 InterPro IPR010083 Beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabA
3 169 SUPERFAMILY SSF54637 Thioesterase/thiol ester dehydrase-isomerase
3 169 InterPro IPR029069 HotDog domain superfamily
1 172 Gene3D G3DSA:3.10.129.10 Hotdog Thioesterase

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.062
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.022
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #5
0.288
Show in viewer
Surrounding area
Residue sets
UniProt: Active site:71-71
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GL47
AlphaFold DB full sequence Viewing
ColabFold VK055_1504
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

63 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 13 records from similar proteins
Structural ligands 13 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
1R3 PDB via homolog 532.6 Da · LogP 3.00 · TPSA 185.6 Open detail RCSB PDB
3MQ PDB via homolog Detail RCSB PDB
4JC PDB via homolog Detail RCSB PDB
54F PDB via homolog Detail RCSB PDB
5VO PDB via homolog Detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
1R3 RCSB PDB P0A6Q3 532.6 Da LogP 3.00 TPSA 185.6 2 viol. ✓ Clean CCCCCCCCCS(CCCNC(=O)CCNC(=O)[C@@H](C(C)(C)COP(=…
3MQ RCSB PDB O33877 181.2 Da LogP 1.90 TPSA 46.3 ✓ Ro5 ✓ Clean c1cc(sc1)c2cc(no2)CO
4JC RCSB PDB O33877 185.2 Da LogP 0.90 TPSA 60.2 ✓ Ro5 ✓ Clean CCc1ccc(cc1)S(=O)(=O)N
54F RCSB PDB O33877 186.2 Da LogP 2.46 TPSA 48.1 ✓ Ro5 ✓ Clean c1ccnc(c1)Oc2cccc(c2)N
5VO RCSB PDB Q8ZG80 206.2 Da LogP 2.51 TPSA 54.4 ✓ Ro5 ✓ Clean c1ccc(cc1)C(=O)CCCCC(=O)O
7SB RCSB PDB O33877 274.7 Da LogP 3.33 TPSA 66.7 ✓ Ro5 ✓ Clean c1cc(oc1)c2[nH]nc(n2)NCc3ccc(cc3)Cl
C9H RCSB PDB O33877 171.3 Da LogP 2.09 TPSA 41.6 ✓ Ro5 ✓ Clean CCCCCSc1[nH]ncn1
DAC RCSB PDB P0A6Q3 271.4 Da LogP 3.30 TPSA 46.2 ✓ Ro5 ✓ Clean CCCCCCC\C=C/C(=O)SCCNC(=O)C
IBK RCSB PDB O33877 294.4 Da LogP 2.69 TPSA 64.4 ✓ Ro5 ✓ Clean CC(C)CNC(=O)COCc1cc(on1)c2cccs2
KBP RCSB PDB O33877 289.4 Da LogP 2.49 TPSA 66.4 ✓ Ro5 ✓ Clean CCCCCCC[C@H](CC(=O)SCCNC(=O)C)O
TQH RCSB PDB O33877 260.3 Da LogP 3.05 TPSA 66.7 ✓ Ro5 ✓ Clean Cc1ccc(o1)CNc2[nH]c(nn2)c3cccs3
TZQ RCSB PDB O33877 270.6 Da LogP 3.35 TPSA 59.7 ✓ Ro5 ✓ Clean c1cc(c(cc1OCc2ccc(o2)C(=O)O)Cl)F
U0W RCSB PDB O33877 258.3 Da LogP 3.05 TPSA 59.7 ✓ Ro5 ✓ Clean c1cc2c(cc1OCc3ccc(o3)C(=O)O)CCC2

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.