Protein target profile

VK055_1793

succinyl-CoA synthetase, alpha subunit

Genome: KpATCC43816 Gene: AIK80406.1 sucD 3D evidence: AlphaFold DB model + ColabFold model Metabolism 3 reactions UniProt A0A0H3GK43
Length 289
Pocket druggability 0.867
Metabolic reactions 3
Chokepoint No
Direct ligand evidence 0 118 total records
Functional annotation 1 EC 6 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
68.707 Lower values reduce human off-target concern.
Human E-value
5.6300000000000005e-64
Gut microbiome similarity
12.2% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
95.502 Higher values support similarity to known essential genes.
DEG E-value
0.0 Smaller values mean stronger essential-gene similarity.

Localization

Localization
Cytoplasmic

Structure confidence

ColabFold pLDDT
97.53 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

The selected pocket score is the FPocket value used for ranking after applying the curated structure priority. It estimates small-molecule pocket quality; it is not experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

FPocket 0.867
Structure A0A0H3GK43
Pocket Pocket 2
P2Rank 0.102
Structure A0A0H3GK43
Pocket Pocket 1
ColabFold model
FPocket 0.545 · Pocket 3
P2Rank 0.11 · Pocket 1
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 579 / 4744 genomes with a hit
Prevalence 12.2%

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

Explore metabolic network

Metabolic context: more central than 95.8% of genes in this genome.

Relative network centrality 95.8% more central than 95.8% of genes in this genome
Chokepoint Not a chokepoint
Catalyzed reactions

3 reactions mapped to this gene in the metabolic model. Open the full network to see each one, with substrates/products and the reaction-reaction map.

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MSVLINKDTKVICQGFTGSQGTFHSEQAIAYGTQMVGGVTPGKGGTTHLGLPVFNTVREAVEATGATATVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEAGVRMIGPNCPGVITPGECKIGIMPGHIHKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTCVGIGGDPIPGSNFIDILKMFEEDPQTEAIVMIGEIGGSAEEEAAAYIKDHVTKPVVGYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKAIIK

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 6 GO

Enzyme Commission (EC)

1

Gene Ontology (GO)

6
  • GO:0003824 Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
  • GO:0009361 A heterodimeric enzyme complex, composed of an alpha and beta chain, most usually found in (but not limited to) bacteria. Functions in the TCA cycle, hydrolyzing succinyl-CoA into succinate and CoA, thereby forming ATP.
  • GO:0000166 Binding to a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
  • GO:0004775 Catalysis of the reaction: ATP + succinate + CoA = ADP + succinyl-CoA + phosphate.
  • GO:0004776 Catalysis of the reaction: GTP + succinate + CoA = GDP + succinyl-CoA + phosphate.
  • GO:0006099 A nearly universal metabolic pathway in which the acetyl group of acetyl coenzyme A is effectively oxidized to two CO2 and four pairs of electrons are transferred to coenzymes. The acetyl group combines with oxaloacetate to form citrate, which undergoes successive transformations to isocitrate, 2-oxoglutarate, succinyl-CoA, succinate, fumarate, malate, and oxaloacetate again, thus completing the cycle. In eukaryotes the tricarboxylic acid is confined to the mitochondria. See also glyoxylate cycle.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

30 records
Show feature table
Start End DB Term Name
236 249 ProSitePatterns PS00399 ATP-citrate lyase / succinyl-CoA ligases family active site.
236 249 InterPro IPR017440 ATP-citrate lyase/succinyl-CoA ligase, active site
3 287 PANTHER PTHR11117 SUCCINYL-COA LIGASE SUBUNIT ALPHA
82 99 PRINTS PR01798 Succinyl-CoA synthase signature
208 221 PRINTS PR01798 Succinyl-CoA synthase signature
240 257 PRINTS PR01798 Succinyl-CoA synthase signature
177 195 PRINTS PR01798 Succinyl-CoA synthase signature
1 289 PIRSF PIRSF001553 SucCS_alpha
1 289 InterPro IPR005810 Succinyl-CoA ligase, alpha subunit
120 289 FunFam G3DSA:3.40.50.261:FF:000002 Succinate--CoA ligase [ADP-forming] subunit alpha
1 119 Gene3D G3DSA:3.40.50.720 -
123 287 SUPERFAMILY SSF52210 Succinyl-CoA synthetase domains
123 287 InterPro IPR016102 Succinyl-CoA synthetase-like
151 271 Pfam PF00549 CoA-ligase
151 271 InterPro IPR005811 ATP-citrate lyase/succinyl-CoA ligase
1 122 SUPERFAMILY SSF51735 NAD(P)-binding Rossmann-fold domains
1 122 InterPro IPR036291 NAD(P)-binding domain superfamily
1 120 FunFam G3DSA:3.40.50.720:FF:000002 Succinate--CoA ligase [ADP-forming] subunit alpha
120 289 Gene3D G3DSA:3.40.50.261 -
120 289 InterPro IPR016102 Succinyl-CoA synthetase-like
4 287 NCBIfam TIGR01019 succinate--CoA ligase subunit alpha
4 287 InterPro IPR005810 Succinyl-CoA ligase, alpha subunit
1 288 Hamap MF_01988 Succinate--CoA ligase [ADP-forming] subunit alpha [sucD].
1 288 InterPro IPR005810 Succinyl-CoA ligase, alpha subunit
152 181 ProSitePatterns PS01216 ATP-citrate lyase / succinyl-CoA ligases family signature 1.
152 181 InterPro IPR033847 ATP-citrate lyase/succinyl-CoA ligase, conserved site
6 99 Pfam PF02629 CoA binding domain
6 99 InterPro IPR003781 CoA-binding
4 100 SMART SM00881 CoA_binding_2
4 100 InterPro IPR003781 CoA-binding

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · FPocket

Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Site 1 FPocket #2
0.867
Likely same site as P2Rank 3 1.4 Å 12 shared residues 100% of smaller site
Unusual size
Show in viewer
Surrounding area

Binding pockets · P2Rank

Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Site 1 P2Rank #1
0.102
Show in viewer
Surrounding area
Site 2 P2Rank #2
0.094
Show in viewer
Surrounding area
Site 3 P2Rank #3
0.088
Likely same site as FPocket 2 1.4 Å 12 shared residues 100% of smaller site
Show in viewer
Surrounding area
Site 4 P2Rank #4
0.06
Show in viewer
Surrounding area
Site 5 P2Rank #5
0.01
Show in viewer
Surrounding area
Residue sets
UniProt: Active site:247-247 Tele-phosphohistidine intermediate
UniProt: Binding site:159-159
UniProt: Binding site:17-20
UniProt: Binding site:43-43
UniProt: Binding site:96-98
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GK43
AlphaFold DB full sequence Viewing
ColabFold VK055_1793
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

118 records
Chemistry signal

Structural and bioactivity evidence are both available for this target.

Direct evidence 0 same-protein records
Transferred evidence 68 records from similar proteins
Structural ligands 12 0 loaded crystals
Measured bioactivity 56 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
7A2 PDB via homolog 208.1 Da · LogP -2.28 · TPSA 152.4 Open detail RCSB PDB
7A3 PDB via homolog Detail RCSB PDB
CAO PDB via homolog Detail RCSB PDB
DCA PDB via homolog Detail RCSB PDB
FLC PDB via homolog Detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
7A2 RCSB PDB P53396 208.1 Da LogP -2.28 TPSA 152.4 ✓ Ro5 ✓ Clean C(C(=O)O)[C@]([C@H](C(=O)O)O)(C(=O)O)O
7A3 RCSB PDB P53396 208.1 Da LogP -2.28 TPSA 152.4 ✓ Ro5 ✓ Clean C(C(=O)O)[C@]([C@@H](C(=O)O)O)(C(=O)O)O
CAO RCSB PDB P53396 783.5 Da LogP -1.39 TPSA 366.8 3 viol. ✓ Clean CC(C)(CO[P@](=O)(O)O[P@](=O)(O)OC[C@@H]1[C@H]([…
DCA RCSB PDB O19069 735.5 Da LogP -1.58 TPSA 346.6 3 viol. ✓ Clean CCNC(=O)CCNC(=O)[C@@H](C(C)(C)CO[P@@](=O)(O)O[P…
FLC RCSB PDB P53396 189.1 Da LogP -5.25 TPSA 140.6 ✓ Ro5 ✓ Clean C(C(=O)[O-])C(CC(=O)[O-])(C(=O)[O-])O
LBG RCSB PDB P53396 453.9 Da LogP 4.58 TPSA 92.7 ✓ Ro5 ✓ Clean COC(=O)c1cc(c(c(c1)Cl)O)S(=O)(=O)Nc2cc(c(cc2F)F…
OAA RCSB PDB P53396 131.1 Da LogP -2.22 TPSA 94.5 ✓ Ro5 ✓ Clean C(C(=O)C(=O)O)C(=O)[O-]
Q5B RCSB PDB P53396 941.6 Da LogP -2.65 TPSA 458.5 3 viol. ✓ Clean CC(C)(COP(=O)(O)OP(=O)(O)OC[C@@H]1[C@H]([C@H]([…
SIN RCSB PDB O19069 118.1 Da LogP -0.06 TPSA 74.6 ✓ Ro5 ✓ Clean C(CC(=O)O)C(=O)O
TLA RCSB PDB P53396 150.1 Da LogP -2.12 TPSA 115.1 ✓ Ro5 ✓ Clean [C@@H]([C@H](C(=O)O)O)(C(=O)O)O
TUY RCSB PDB P53597 899.6 Da LogP -3.53 TPSA 441.4 3 viol. ✓ Clean CC(C)(COP(=O)(O)OP(=O)(O)OC[C@@H]1[C@H]([C@H]([…
Y2A RCSB PDB P53396 272.1 Da LogP -1.70 TPSA 178.7 ✓ Ro5 ✓ Clean C(C(=O)O)[C@](CC(=O)OP(=O)(O)O)(C(=O)O)O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.