KpATCC43816 Protein target profile
rRNA large subunit m3Psi methyltransferase RlmH
Accession: VK055_1864
Promising target candidate with multiple supporting evidence streams.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Evidence coverage
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- No hit
- Gut microbiome similarity
- 3.6% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- Y
- DEG identity (%)
- 94.444 Higher values support similarity to known essential genes.
- DEG E-value
- 4.6799999999999997e-101 Smaller values mean stronger essential-gene similarity.
Structure confidence
- ColabFold pLDDT
- 96.22 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MPDWVQTGFSEYLRRFPKDMPFELVEIPAGKRGKNADIKRILEKEGEMMLAAAGKNRIVTLDIPGKPWDTPQLARELERWKQDGRDVSLLVGGPEGLSPACKAAAEQSWSLSTLTLPHPLVRVLVAESLYRAWSITTNHPYHRE
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- Unknown
Enzyme Commission (EC)
1Gene Ontology (GO)
4- GO:0006364 Any process involved in the conversion of a primary ribosomal RNA (rRNA) transcript into one or more mature rRNA molecules.
- GO:0008168 Catalysis of the transfer of a methyl group to an acceptor molecule.
- GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
- GO:0070038 Catalysis of the reaction: S-adenosyl-L-methionine + rRNA = S-adenosyl-L-homocysteine + rRNA containing N3-methylpseudouridine.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 1 | 143 | Hamap | MF_00658 | Ribosomal RNA large subunit methyltransferase H [rlmH]. |
| 1 | 143 | InterPro | IPR003742 | RNA methyltransferase RlmH |
| 1 | 143 | CDD | cd18081 | RlmH-like |
| 1 | 143 | PIRSF | PIRSF004505 | MT_bac |
| 3 | 143 | PANTHER | PTHR33603 | METHYLTRANSFERASE |
| 3 | 143 | InterPro | IPR003742 | RNA methyltransferase RlmH |
| 1 | 144 | NCBIfam | TIGR00246 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH |
| 1 | 144 | InterPro | IPR003742 | RNA methyltransferase RlmH |
| 2 | 142 | Pfam | PF02590 | Predicted SPOUT methyltransferase |
| 2 | 142 | InterPro | IPR003742 | RNA methyltransferase RlmH |
| 1 | 142 | SUPERFAMILY | SSF75217 | alpha/beta knot |
| 1 | 142 | InterPro | IPR029028 | Alpha/beta knot methyltransferases |
| 1 | 144 | Gene3D | G3DSA:3.40.1280.10 | - |
| 1 | 144 | InterPro | IPR029026 | tRNA (guanine-N1-)-methyltransferase, N-terminal |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Residue sets
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Residue sets
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GJY6
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
VK055_1864
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural ligand evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC13650200 ZINC | 1.000 | 381.4 Da LogP -2.06 TPSA 208.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](C[C@H](N)CC[C@H](N)…
|
| ZINC205994753 ZINC | 1.000 | 381.4 Da LogP -2.06 TPSA 208.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](C[C@H](N)CC[C@H](N)…
|
| ZINC205994774 ZINC | 1.000 | 381.4 Da LogP -2.06 TPSA 208.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](C[C@H](N)CC[C@H](N)…
|
| ZINC27723577 ZINC | 1.000 | 381.4 Da LogP -2.06 TPSA 208.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](C[C@H](N)CC[C@H](N)…
|
| ZINC38192471 ZINC | 1.000 | 381.4 Da LogP -2.06 TPSA 208.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](C[C@H](N)CC[C@@H](N…
|
| ZINC38192472 ZINC | 1.000 | 381.4 Da LogP -2.06 TPSA 208.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](C[C@@H](N)CC[C@@H](…
|
| ZINC4217451 ZINC | 1.000 | 381.4 Da LogP -2.06 TPSA 208.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](C[C@@H](N)CC[C@H](N…
|
| ZINC13522400 ZINC | 0.737 | 400.4 Da LogP -2.42 TPSA 199.7 | 1 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](C[S@](=O)CC[C@H](N)…
|
| ZINC13522403 ZINC | 0.737 | 400.4 Da LogP -2.42 TPSA 199.7 | 1 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](C[S@@](=O)CC[C@H](N…
|
| ZINC13522378 ZINC | 0.732 | 370.4 Da LogP -1.83 TPSA 182.6 | 1 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CSC[C@H](N)C(=O)O)[…
|
| ZINC13522407 ZINC | 0.732 | 370.4 Da LogP -1.83 TPSA 182.6 | 1 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CSC[C@H](N)C(=O)O)[…
|
| ZINC256828117 ZINC | 0.732 | 370.4 Da LogP -1.83 TPSA 182.6 | 1 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CSC[C@H](N)C(=O)O)[…
|
| ZINC256828118 ZINC | 0.732 | 370.4 Da LogP -1.83 TPSA 182.6 | 1 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CSC[C@H](N)C(=O)O)[…
|
| ZINC1775937521 ZINC | 0.726 | 423.5 Da LogP -1.02 TPSA 194.7 | 2 viol. | ✓ Clean |
CCCN[C@H](CC[C@H](N)C(=O)O)C[C@H]1O[C@@H](n2cnc…
|
| ZINC95921230 ZINC | 0.726 | 423.5 Da LogP -1.02 TPSA 194.7 | 2 viol. | ✓ Clean |
CCCN[C@@H](CC[C@H](N)C(=O)O)C[C@H]1O[C@@H](n2cn…
|
| ZINC12501055 ZINC | 0.724 | 384.4 Da LogP -1.44 TPSA 182.6 | 1 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CSCC[C@H](N)C(=O)O)…
|
| ZINC13509082 ZINC | 0.724 | 384.4 Da LogP -1.44 TPSA 182.6 | 1 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](CSCC[C@@H](N)C(=O)O…
|
| ZINC13509104 ZINC | 0.724 | 384.4 Da LogP -1.44 TPSA 182.6 | 1 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CSCC[C@@H](N)C(=O)O…
|
| ZINC1532516 ZINC | 0.724 | 384.4 Da LogP -1.44 TPSA 182.6 | 1 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](CSCC[C@H](N)C(=O)O)…
|
| ZINC33821012 ZINC | 0.724 | 384.4 Da LogP -1.44 TPSA 182.6 | 1 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CSCC[C@H](N)C(=O)O)…
|
| ZINC33821013 ZINC | 0.724 | 384.4 Da LogP -1.44 TPSA 182.6 | 1 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CSCC[C@H](N)C(=O)O)…
|
| ZINC4228232 ZINC | 0.724 | 384.4 Da LogP -1.44 TPSA 182.6 | 1 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CSCC[C@H](N)C(=O)O)…
|
| ZINC45789230 ZINC | 0.724 | 384.4 Da LogP -1.44 TPSA 182.6 | 1 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](CSCC[C@H](N)C(=O)O…
|
| ZINC45789233 ZINC | 0.724 | 384.4 Da LogP -1.44 TPSA 182.6 | 1 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@H](CSCC[C@H](N)C(=O)O)[…
|
| ZINC49014951 ZINC | 0.724 | 416.4 Da LogP -2.76 TPSA 216.8 | 1 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@H](CS(=O)(=O)CC[C@H](N)…
|
| ZINC49014955 ZINC | 0.724 | 416.4 Da LogP -2.76 TPSA 216.8 | 1 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@H](CS(=O)(=O)CC[C@@H](N…
|
| ZINC100005972 ZINC | 0.712 | 400.5 Da LogP -1.54 TPSA 182.6 | 1 viol. | ✓ Clean |
C[S@@H](CC[C@H](N)C(=O)O)C[C@H]1O[C@@H](n2cnc3c…
|
| ZINC12371977 ZINC | 0.700 | 399.5 Da LogP -1.92 TPSA 182.6 | ✓ Ro5 | ✓ Clean |
C[S@@+](CC[C@H](N)C(=O)O)C[C@H]1O[C@@H](n2cnc3c…
|
| ZINC12371978 ZINC | 0.700 | 399.5 Da LogP -1.92 TPSA 182.6 | ✓ Ro5 | ✓ Clean |
C[S@+](CC[C@H](N)C(=O)O)C[C@H]1O[C@@H](n2cnc3c(…
|
| ZINC13522357 ZINC | 0.700 | 399.5 Da LogP -1.92 TPSA 182.6 | ✓ Ro5 | ✓ Clean |
C[S@@+](CC[C@@H](N)C(=O)O)C[C@H]1O[C@@H](n2cnc3…
|
| ZINC13522362 ZINC | 0.700 | 399.5 Da LogP -1.92 TPSA 182.6 | ✓ Ro5 | ✓ Clean |
C[S@+](CC[C@@H](N)C(=O)O)C[C@H]1O[C@@H](n2cnc3c…
|
| ZINC139339614 ZINC | 0.700 | 399.5 Da LogP -1.92 TPSA 182.6 | ✓ Ro5 | ✓ Clean |
C[S@@+](CC[C@H](N)C(=O)O)C[C@@H]1O[C@H](n2cnc3c…
|
| ZINC254297245 ZINC | 0.700 | 399.5 Da LogP -1.92 TPSA 182.6 | ✓ Ro5 | ✓ Clean |
C[S@+](CC[C@H](N)C(=O)O)C[C@@H]1O[C@H](n2cnc3c(…
|
| ZINC254297254 ZINC | 0.700 | 399.5 Da LogP -1.92 TPSA 182.6 | ✓ Ro5 | ✓ Clean |
C[S@+](CC[C@H](N)C(=O)O)C[C@@H]1O[C@H](n2cnc3c(…
|
| ZINC254297257 ZINC | 0.700 | 399.5 Da LogP -1.92 TPSA 182.6 | ✓ Ro5 | ✓ Clean |
C[S@+](CC[C@H](N)C(=O)O)C[C@@H]1O[C@H](n2cnc3c(…
|
| ZINC33821030 ZINC | 0.700 | 399.5 Da LogP -1.92 TPSA 182.6 | ✓ Ro5 | ✓ Clean |
C[S@@+](CC[C@H](N)C(=O)O)C[C@H]1O[C@@H](n2cnc3c…
|
| ZINC33821031 ZINC | 0.700 | 399.5 Da LogP -1.92 TPSA 182.6 | ✓ Ro5 | ✓ Clean |
C[S@+](CC[C@H](N)C(=O)O)C[C@H]1O[C@@H](n2cnc3c(…
|
| ZINC4214738 ZINC | 0.700 | 399.5 Da LogP -1.92 TPSA 182.6 | ✓ Ro5 | ✓ Clean |
C[S@@+](CC[C@H](N)C(=O)O)C[C@H]1O[C@@H](n2cnc3c…
|
| ZINC4228231 ZINC | 0.700 | 399.5 Da LogP -1.92 TPSA 182.6 | ✓ Ro5 | ✓ Clean |
C[S@+](CC[C@H](N)C(=O)O)C[C@H]1O[C@@H](n2cnc3c(…
|
| ZINC71755544 ZINC | 0.700 | 399.5 Da LogP -1.92 TPSA 182.6 | ✓ Ro5 | ✓ Clean |
C[S@+](CC[C@@H](N)C(=O)O)C[C@@H]1O[C@H](n2cnc3c…
|
| ZINC71755557 ZINC | 0.700 | 399.5 Da LogP -1.92 TPSA 182.6 | ✓ Ro5 | ✓ Clean |
C[S@@+](CC[C@@H](N)C(=O)O)C[C@@H]1O[C@H](n2cnc3…
|
| ZINC95644663 ZINC | 0.700 | 399.5 Da LogP -1.92 TPSA 182.6 | ✓ Ro5 | ✓ Clean |
C[S@@+](CC[C@H](N)C(=O)O)C[C@H]1O[C@@H](n2cnc3c…
|
| ZINC95644664 ZINC | 0.700 | 399.5 Da LogP -1.92 TPSA 182.6 | ✓ Ro5 | ✓ Clean |
C[S@+](CC[C@H](N)C(=O)O)C[C@H]1O[C@@H](n2cnc3c(…
|
| ZINC5139067 ZINC | 0.654 | 283.3 Da LogP -1.04 TPSA 119.3 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CS)[C@@H](O)[C@H]1O
|
| ZINC4513750 ZINC | 0.648 | 281.2 Da LogP -1.89 TPSA 156.6 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](C(=O)O)[C@@H](O)[C@…
|
| ZINC4513754 ZINC | 0.648 | 281.2 Da LogP -1.89 TPSA 156.6 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](C(=O)O)[C@@H](O)[C…
|
| ZINC4513757 ZINC | 0.648 | 281.2 Da LogP -1.89 TPSA 156.6 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](C(=O)O)[C@@H](O)[C@…
|
| ZINC4513760 ZINC | 0.648 | 281.2 Da LogP -1.89 TPSA 156.6 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](C(=O)O)[C@@H](O)[C…
|
| ZINC5163034 ZINC | 0.648 | 281.2 Da LogP -1.89 TPSA 156.6 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](C(=O)O)[C@@H](O)[C@…
|
| ZINC13551750 ZINC | 0.645 | 379.4 Da LogP -1.94 TPSA 208.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O/C(=C\[C@@H](N)CC[C@@H](N…
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.