KpATCC43816 Protein target profile
phospho-N-acetylmuramoyl-pentapeptide- transferase
Accession: VK055_2481
Strong target candidate with converging metabolic, structural and chemical evidence.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Evidence coverage
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- No hit
- Gut microbiome similarity
- 6.8% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- Y
- DEG identity (%)
- 97.727 Higher values support similarity to known essential genes.
- DEG E-value
- 0.0 Smaller values mean stronger essential-gene similarity.
Structure confidence
- ColabFold pLDDT
- 91.66 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MVKYYSGFNVFSYLTFRAIVSLLTALFISLWMGPRMIARLQKLAFGQVVRNDGPESHFSKRGTPTMGGIMILTAITVSVLLWAYPSNPYVWCVLTVLIGYGIIGFVDDYRKVVRKDTKGLIARWKYFWMSVIALGVAFALYLAGKDTPATELVVPFFKDVMPQLGLFYILLAYFVIVGTGNAVNLTDGLDGLAIMPTVFVAAGFALVAWATGNMNFANYLHIPYLRHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGIIAVLLRQEFLLVIMGGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIGLATLKVR
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- CytoplasmicMembrane
Enzyme Commission (EC)
1Gene Ontology (GO)
10- GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
- GO:0008963 Catalysis of the reaction: di-trans,octa-cis-undecaprenyl phosphate + UDP-N-acetyl-alpha-D-muramoyl-L-alanyl-gamma-D-glutamyl-L-lysyl-D-alanyl-D-alanine = Mur2Ac(oyl-L-Ala-gamma-D-Glu-L-Lys-D-Ala-D-Ala)-di-trans,octa-cis-undecaprenyl diphosphate + UMP.
- GO:0016780 Catalysis of the transfer of a substituted phosphate group, other than diphosphate or nucleotidyl residues, from one compound (donor) to a another (acceptor).
- GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
- GO:0046872 Binding to a metal ion.
- GO:0051992 Catalysis of the reaction: di-trans,octa-cis-undecaprenyl phosphate + UDP-N-acetyl-alpha-D-muramoyl-L-alanyl-gamma-D-glutamyl-meso-2,6-diaminopimeloyl-D-alanyl-D-alanine = di-trans-octa-cis-undecaprenyl diphospho-N-acetyl-alpha-D-muramoyl-L-alanyl-D-glutamyl-meso-2,6-diaminopimeloyl-D-alanyl-D-alanine + UMP.
- GO:0051301 The process resulting in division and partitioning of components of a cell to form more cells; may or may not be accompanied by the physical separation of a cell into distinct, individually membrane-bounded daughter cells.
- GO:0071555 A process that results in the assembly, arrangement of constituent parts, or disassembly of the cell wall, the rigid or semi-rigid envelope lying outside the cell membrane of plant, fungal and most prokaryotic cells, maintaining their shape and protecting them from osmotic lysis.
- GO:0009252 The chemical reactions and pathways resulting in the formation of peptidoglycans, any of a class of glycoconjugates found in bacterial cell walls and consisting of long glycan strands of alternating residues of beta-(1,4) linked N-acetylglucosamine and N-acetylmuramic acid, cross-linked by short peptides.
- GO:0008360 Any process that modulates the surface configuration of a cell.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 249 | 254 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 255 | 276 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 53 | 348 | CDD | cd06852 | GT_MraY |
| 53 | 348 | InterPro | IPR003524 | Phospho-N-acetylmuramoyl-pentapeptide transferase |
| 181 | 192 | ProSitePatterns | PS01348 | MraY family signature 2. |
| 181 | 192 | InterPro | IPR018480 | Phospho-N-acetylmuramoyl-pentapeptide transferase, conserved site |
| 33 | 64 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 192 | 211 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 17 | 350 | Hamap | MF_00038 | Phospho-N-acetylmuramoyl-pentapeptide-transferase [mraY]. |
| 17 | 350 | InterPro | IPR003524 | Phospho-N-acetylmuramoyl-pentapeptide transferase |
| 126 | 144 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 282 | 303 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 1 | 11 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 65 | 82 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 91 | 276 | Pfam | PF00953 | Glycosyl transferase family 4 |
| 91 | 276 | InterPro | IPR000715 | Glycosyl transferase, family 4 |
| 60 | 72 | ProSitePatterns | PS01347 | MraY family signature 1. |
| 60 | 72 | InterPro | IPR018480 | Phospho-N-acetylmuramoyl-pentapeptide transferase, conserved site |
| 107 | 125 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 10 | 32 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 164 | 185 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 330 | 349 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 255 | 277 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 88 | 106 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 15 | 350 | PANTHER | PTHR22926 | PHOSPHO-N-ACETYLMURAMOYL-PENTAPEPTIDE-TRANSFERASE |
| 15 | 350 | InterPro | IPR000715 | Glycosyl transferase, family 4 |
| 304 | 329 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 226 | 248 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 83 | 87 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 281 | 303 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 12 | 32 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 192 | 211 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 60 | 72 | Pfam | PF10555 | Phospho-N-acetylmuramoyl-pentapeptide-transferase signature 1 |
| 277 | 281 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 89 | 106 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 350 | 352 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 145 | 163 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 186 | 191 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 126 | 143 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 212 | 230 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 330 | 349 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 231 | 248 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 163 | 185 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 67 | 84 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 29 | 352 | NCBIfam | TIGR00445 | phospho-N-acetylmuramoyl-pentapeptide-transferase |
| 29 | 352 | InterPro | IPR003524 | Phospho-N-acetylmuramoyl-pentapeptide transferase |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Residue sets
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Residue sets
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GI63
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
VK055_2481
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural and bioactivity evidence are both available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| NK4 RCSB PDB | O66465 | 798.0 Da LogP 1.05 TPSA 250.3 | 3 viol. | ✓ Clean |
CCCCCCCCCCCCCCCCC[C@H]1CN([C@H](C(=O)N([C@@H]1C…
|
|
| NKD RCSB PDB | O66465 | 856.9 Da LogP -1.83 TPSA 328.0 | 3 viol. | ✓ Clean |
C[C@@H]([C@@H](C(=O)N/C=C\1/[C@H]([C@H]([C@@H](…
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
| Ligand | UniProt (homolog) | pchembl | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| CHEMBL4286766 ChEMBL | P0C1R8 | 10.80 ~0.0 nM | 946.0 Da LogP -6.69 TPSA 432.6 | 3 viol. | ✓ Clean |
CO[C@H]1[C@H](O[C@H]([C@H]2O[C@@H](n3ccc(=O)[nH…
|
| CHEMBL4284923 ChEMBL | P0C1R8 | 10.03 ~0.1 nM | 988.0 Da LogP -6.51 TPSA 435.7 | 3 viol. | ✓ Clean |
CO[C@H]1[C@H](O[C@H]([C@H]2O[C@@H](n3ccc(=O)[nH…
|
| CHEMBL4279378 ChEMBL | O66465 | 9.49 ~0.3 nM | 1156.3 Da LogP -1.58 TPSA 438.7 | 3 viol. | ✓ Clean |
CO[C@H]1[C@H](O[C@H]([C@H]2O[C@@H](n3ccc(=O)[nH…
|
| CHEMBL4475677 ChEMBL | P0C1R8 | 8.59 ~2.6 nM | 784.0 Da LogP 0.71 TPSA 259.1 | 3 viol. | ✓ Clean |
CCCCCCCCCCCCCCCCC[C@@H]1CN[C@@H]([C@H](O[C@@H]2…
|
| 57M ChEMBL | Q03521 | 8.12 ~7.6 nM | 916.0 Da LogP -6.52 TPSA 425.9 | 3 viol. | ✓ Clean |
CC(C)C[C@@H](C(=O)NCCCN[C@@H]([C@@H]([C@@H]1[C@…
|
| CHEMBL5282738 ChEMBL | E2QF15 | 8.00 ~10.0 nM | 649.7 Da LogP -3.07 TPSA 242.8 | 3 viol. | ✓ Clean |
CO[C@H]1[C@@H](OC)[C@H](n2ccc(=O)[nH]c2=O)O[C@@…
|
| CHEMBL4283943 ChEMBL | P9WMW7 | 7.96 ~11.0 nM | 930.0 Da LogP -5.66 TPSA 412.4 | 3 viol. | ✓ Clean |
CO[C@H]1[C@H](O[C@H]([C@H]2O[C@@H](n3ccc(=O)[nH…
|
| CHEMBL5265940 ChEMBL | P0C1R8 | 7.77 ~17.0 nM | 583.6 Da LogP -4.18 TPSA 253.8 | 3 viol. | ✓ Clean |
CO[C@H]1[C@@H](O)[C@H](n2ccc(=O)[nH]c2=O)O[C@@H…
|
| CHEMBL95027 ChEMBL | P0A6W3 | 7.77 ~17.0 nM | 583.6 Da LogP -4.18 TPSA 253.8 | 3 viol. | ✓ Clean |
CO[C@H]1[C@@H](O)[C@H](n2ccc(=O)[nH]c2=O)O[C@@H…
|
| NKM ChEMBL | P0A6W3 | 7.75 ~17.8 nM | 569.5 Da LogP -4.57 TPSA 253.8 | 3 viol. | ✓ Clean |
CO[C@H]1[C@H]([C@@H](O[C@@H]1[C@H](C(=O)N)O[C@@…
|
| CHEMBL2048825 ChEMBL | P0C1R8 | 7.66 ~21.9 nM | 711.7 Da LogP -1.68 TPSA 283.1 | 3 viol. | ✓ Clean |
C[C@H](N)C(=O)N(C)[C@@H](C)[C@H](NC(=O)[C@H](C)…
|
| CHEMBL2048828 ChEMBL | P0C1R8 | 7.66 ~21.9 nM | 876.9 Da LogP -2.67 TPSA 352.6 | 3 viol. | ✓ Clean |
C[C@H](NC(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)O)C…
|
| CHEMBL5272467 ChEMBL | Q03521 | 7.66 ~21.9 nM | 726.7 Da LogP -2.74 TPSA 309.1 | 3 viol. | ✓ Clean |
C[C@@H](NC(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)O)…
|
| CHEMBL4473600 ChEMBL | P0C1R8 | 7.62 ~24.0 nM | 711.9 Da LogP 0.66 TPSA 230.6 | 3 viol. | ✓ Clean |
CCCCCCCCCCCCCCCC(=O)N[C@H]1CCN[C@H]([C@H](O[C@@…
|
| CHEMBL5277590 ChEMBL | P0C1R8 | 7.57 ~26.9 nM | 473.4 Da LogP -4.18 TPSA 221.9 | 1 viol. | ✓ Clean |
COC(=O)C1=C[C@@H](O)[C@@H](O)[C@H](O[C@@H](C(N)…
|
| CHEMBL2048826 ChEMBL | P0C1R8 | 7.38 ~41.7 nM | 727.7 Da LogP -2.71 TPSA 303.3 | 3 viol. | ✓ Clean |
C[C@H](N)C(=O)N(C)[C@@H](C)[C@H](NC(=O)[C@H](C)…
|
| CHEMBL5271984 ChEMBL | Q03521 | 7.38 ~41.7 nM | 713.7 Da LogP -3.05 TPSA 312.1 | 3 viol. | ✓ Clean |
C[C@H](N)C(=O)N[C@@H](C)[C@H](NC(=O)[C@H](C)NC(…
|
| CHEMBL1780217 ChEMBL | Q03521 | 7.31 ~49.0 nM | 916.0 Da LogP -6.31 TPSA 423.4 | 3 viol. | ✓ Clean |
CC(C)C[C@@H](NC(=O)[C@@H](NC(=O)N[C@H](C(=O)O)C…
|
| CHEMBL5278937 ChEMBL | E2QF15 | 7.24 ~57.5 nM | 601.6 Da LogP -4.62 TPSA 253.8 | 3 viol. | ✓ Clean |
CO[C@H]1[C@@H](O)[C@H](n2ccc(=O)[nH]c2=O)O[C@@H…
|
| CHEMBL2048830 ChEMBL | P0C1R8 | 7.19 ~64.6 nM | 713.7 Da LogP -3.10 TPSA 303.3 | 3 viol. | ✓ Clean |
C[C@H](NC(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)O)C…
|
| CHEMBL1780218 ChEMBL | Q03521 | 6.61 ~245.5 nM | 1070.3 Da LogP -1.88 TPSA 423.4 | 3 viol. | ✓ Clean |
CCCCCCCCCCCCCCC[C@H](NC(=O)[C@@H](NC(=O)N[C@H](…
|
| 9LH ChEMBL | P0C1R8 | 6.60 ~251.2 nM | 830.9 Da LogP -2.48 TPSA 311.8 | 3 viol. | ✓ Clean |
CC(C)CCCCCCCCC/C=C/C(=O)N[C@@H]1[C@H]([C@H]([C@…
|
| CHEMBL5279603 ChEMBL | P0C1R8 | 6.52 ~302.0 nM | 490.5 Da LogP -3.42 TPSA 215.5 | 2 viol. | ✓ Clean |
NC[C@H]1O[C@@H](O[C@@H](C#Cc2ccc(N)cc2)[C@H]2O[…
|
| CHEMBL5267618 ChEMBL | P0A6W3 | 6.48 ~331.1 nM | 502.6 Da LogP -2.49 TPSA 201.5 | 3 viol. | ✓ Clean |
CCCCCCCNCC(O[C@@H]1O[C@H](CN)[C@@H](O)[C@H]1O)[…
|
| CHEMBL5275061 ChEMBL | P0A6W3 | 6.48 ~331.1 nM | 586.7 Da LogP -0.15 TPSA 201.5 | 3 viol. | ✓ Clean |
CCCCCCCCCCCCCNCC(O[C@@H]1O[C@H](CN)[C@@H](O)[C@…
|
| CHEMBL5276993 ChEMBL | P0A6W3 | 6.48 ~331.1 nM | 558.7 Da LogP -0.93 TPSA 201.5 | 3 viol. | ✓ Clean |
CCCCCCCCCCCNCC(O[C@@H]1O[C@H](CN)[C@@H](O)[C@H]…
|
| CHEMBL5281271 ChEMBL | P0A6W3 | 6.48 ~331.1 nM | 460.5 Da LogP -3.66 TPSA 201.5 | 2 viol. | ✓ Clean |
CCCCNCC(O[C@@H]1O[C@H](CN)[C@@H](O)[C@H]1O)[C@H…
|
| CHEMBL5288850 ChEMBL | P0A6W3 | 6.48 ~331.1 nM | 530.6 Da LogP -1.71 TPSA 201.5 | 3 viol. | ✓ Clean |
CCCCCCCCCNCC(O[C@@H]1O[C@H](CN)[C@@H](O)[C@H]1O…
|
| CHEMBL5289885 ChEMBL | P0C1R8 | 6.23 ~588.8 nM | 551.6 Da LogP -1.33 TPSA 189.5 | 3 viol. | ✓ Clean |
NC[C@H]1O[C@@H](O[C@@H](C#Cc2ccc(-c3ccccc3)cc2)…
|
| CHEMBL2048831 ChEMBL | P0C1R8 | 6.19 ~645.7 nM | 876.9 Da LogP -2.67 TPSA 352.6 | 3 viol. | ✓ Clean |
C[C@H](NC(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)O)C…
|
| CHEMBL5277496 ChEMBL | P0C1R8 | 6.19 ~645.7 nM | 551.6 Da LogP -1.33 TPSA 189.5 | 3 viol. | ✓ Clean |
NC[C@H]1O[C@@H](O[C@@H](C#Cc2cccc(-c3ccccc3)c2)…
|
| CHEMBL1780219 ChEMBL | Q03521 | 6.16 ~691.8 nM | 1070.3 Da LogP -1.88 TPSA 423.4 | 3 viol. | ✓ Clean |
CCCCCCCCCCCCCCC[C@@H](NC(=O)[C@@H](NC(=O)N[C@H]…
|
| CHEMBL5287014 ChEMBL | P0C1R8 | 6.05 ~891.3 nM | 594.6 Da LogP -1.75 TPSA 218.6 | 3 viol. | ✓ Clean |
NC[C@H]1O[C@@H](O[C@@H](C#Cc2ccc(C(=O)Nc3ccccc3…
|
| CHEMBL5268197 ChEMBL | P0C1R8 | 6.02 ~955.0 nM | 630.6 Da LogP -2.20 TPSA 235.7 | 3 viol. | ✓ Clean |
NC[C@H]1O[C@@H](O[C@@H](C#Cc2cccc(NS(=O)(=O)c3c…
|
| CHEMBL5291217 ChEMBL | P0C1R8 | 6.00 ~1.0 µM | 630.6 Da LogP -2.20 TPSA 235.7 | 3 viol. | ✓ Clean |
NC[C@H]1O[C@@H](O[C@@H](C#Cc2ccc(NS(=O)(=O)c3cc…
|
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
No virtual-screening candidates for this protein.
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.