Promising target candidate with multiple supporting evidence streams.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Evidence coverage
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- No hit
- Gut microbiome similarity
- 4.5% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- Y
- DEG identity (%)
- 91.941 Higher values support similarity to known essential genes.
- DEG E-value
- 8.14e-177 Smaller values mean stronger essential-gene similarity.
Structure confidence
- ColabFold pLDDT
- 96.09 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MHDAQIRVAIAGAGGRMGRQLIQAALQMDGVALGAALEREGSSLVGSDAGELAGAGKAGVAVQSSLAAVKDDFDVLIDFTRPEGTLNHLAFCREHGKGMVIGTTGFDDAGKQAIRDAAQDIAIVFAANFSVGVNVLLKLLEKAAKVMGDYTDIEIIEAHHRHKVDAPSGTALAMGEAIAGALNKDLKDCAVYSREGYTGERVPGTIGFATVRAGDIVGEHTAMFADIGERIEITHKASSRMTFANGAVRSALWLKGKKNGLFDMRDVLDLNSL
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- Cytoplasmic
Enzyme Commission (EC)
1Gene Ontology (GO)
7- GO:0009089 OBSOLETE. The chemical reactions and pathways resulting in the formation of lysine, via the intermediate diaminopimelate.
- GO:0008839 Catalysis of the reaction: (S)-2,3,4,5-tetrahydropyridine-2,6-dicarboxylate + NAD(P)+ + H2O = (2S,4S)-4-hydroxy-2,3,4,5-tetrahydrodipicolinate + NAD(P)H + H+.
- GO:0005829 The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
- GO:0051287 Binding to nicotinamide adenine dinucleotide, a coenzyme involved in many redox and biosynthetic reactions; binding may be to either the oxidized form, NAD+, or the reduced form, NADH.
- GO:0050661 Binding to nicotinamide-adenine dinucleotide phosphate, a coenzyme involved in many redox and biosynthetic reactions; binding may be to either the oxidized form, NADP+, or the reduced form, NADPH.
- GO:0016726 Catalysis of an oxidation-reduction (redox) reaction in which a CH2 group acts as a hydrogen or electron donor and reduces NAD+ or NADP.
- GO:0019877 OBSOLETE. The chemical reactions and pathways resulting in the formation of diaminopimelate, both as an intermediate in lysine biosynthesis and as a component (as meso-diaminopimelate) of the peptidoglycan of Gram-negative bacterial cell walls.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 154 | 171 | ProSitePatterns | PS01298 | Dihydrodipicolinate reductase signature. |
| 154 | 171 | InterPro | IPR022664 | Dihydrodipicolinate reductase, conserved site |
| 6 | 129 | Pfam | PF01113 | Dihydrodipicolinate reductase, N-terminus |
| 6 | 129 | InterPro | IPR000846 | Dihydrodipicolinate reductase, N-terminal |
| 6 | 269 | NCBIfam | TIGR00036 | 4-hydroxy-tetrahydrodipicolinate reductase |
| 6 | 269 | InterPro | IPR023940 | Dihydrodipicolinate reductase |
| 6 | 268 | Gene3D | G3DSA:3.40.50.720 | - |
| 6 | 134 | FunFam | G3DSA:3.40.50.720:FF:000048 | 4-hydroxy-tetrahydrodipicolinate reductase |
| 131 | 238 | Gene3D | G3DSA:3.30.360.10 | Dihydrodipicolinate Reductase; domain 2 |
| 131 | 238 | FunFam | G3DSA:3.30.360.10:FF:000004 | 4-hydroxy-tetrahydrodipicolinate reductase |
| 131 | 240 | SUPERFAMILY | SSF55347 | Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain |
| 132 | 268 | Pfam | PF05173 | Dihydrodipicolinate reductase, C-terminus |
| 132 | 268 | InterPro | IPR022663 | Dihydrodipicolinate reductase, C-terminal |
| 6 | 268 | Hamap | MF_00102 | 4-hydroxy-tetrahydrodipicolinate reductase [dapB]. |
| 6 | 268 | InterPro | IPR023940 | Dihydrodipicolinate reductase |
| 4 | 272 | PIRSF | PIRSF000161 | DHPR |
| 4 | 272 | InterPro | IPR023940 | Dihydrodipicolinate reductase |
| 4 | 271 | SUPERFAMILY | SSF51735 | NAD(P)-binding Rossmann-fold domains |
| 4 | 271 | InterPro | IPR036291 | NAD(P)-binding domain superfamily |
| 5 | 269 | PANTHER | PTHR20836 | DIHYDRODIPICOLINATE REDUCTASE |
| 5 | 269 | InterPro | IPR023940 | Dihydrodipicolinate reductase |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Residue sets
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Residue sets
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GN28
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
VK055_2536
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural ligand evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| 6PC RCSB PDB | P24703 | 123.1 Da LogP 0.78 TPSA 50.2 | ✓ Ro5 | ✓ Clean |
c1ccnc(c1)C(=O)O
|
|
| 7FN RCSB PDB | Q8DEM0 | 156.1 Da LogP 0.68 TPSA 87.7 | ✓ Ro5 | ✓ Clean |
c1cc(oc1C(=O)O)C(=O)O
|
|
| A3D RCSB PDB | P04036 | 662.4 Da LogP -2.54 TPSA 295.1 | 3 viol. | ✓ Clean |
CC(=O)c1ccc[n+](c1)[C@H]2[C@@H]([C@@H]([C@H](O2…
|
|
| AE3 RCSB PDB | P9WP23 | 134.2 Da LogP 0.03 TPSA 38.7 | ✓ Ro5 | ✓ Clean |
CCOCCOCCO
|
|
| BEZ RCSB PDB | A5U6C6 | 122.1 Da LogP 1.38 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
c1ccc(cc1)C(=O)O
|
|
| NHD RCSB PDB | P04036 | 664.4 Da LogP -3.52 TPSA 315.3 | 3 viol. | ✓ Clean |
c1cc(c[n+](c1)[C@H]2[C@@H]([C@@H]([C@H](O2)CO[P…
|
|
| PDC RCSB PDB | P04036 | 167.1 Da LogP 0.48 TPSA 87.5 | ✓ Ro5 | ✓ Clean |
c1cc(nc(c1)C(=O)O)C(=O)O
|
|
| PE3 RCSB PDB | P24703 | 634.8 Da LogP -0.81 TPSA 160.5 | 2 viol. | ✓ Clean |
C(COCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCO)O
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC5650743 ZINC | 1.000 | 222.3 Da LogP 0.07 TPSA 57.2 | ✓ Ro5 | ✓ Clean |
CCOCCOCCOCCOCCO
|
| ZINC6403917 ZINC | 1.000 | 354.4 Da LogP 0.11 TPSA 84.8 | ✓ Ro5 | ✓ Clean |
CCOCCOCCOCCOCCOCCOCCOCCO
|
| ZINC2504355 ZINC | 0.778 | 226.2 Da LogP 2.62 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(C(=O)c2ccccc2)cc1
|
| ZINC34049460 ZINC | 0.762 | 244.2 Da LogP 1.54 TPSA 100.4 | ✓ Ro5 | ✓ Clean |
O=C(O)c1cccc(-c2cccc(C(=O)O)n2)n1
|
| ZINC39222889 ZINC | 0.737 | 222.2 Da LogP 1.94 TPSA 100.9 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(-c2ccc(C(=O)O)o2)o1
|
| ZINC21990496 ZINC | 0.727 | 321.3 Da LogP 2.60 TPSA 113.3 | ✓ Ro5 | ✓ Clean |
O=C(O)c1cccc(-c2cccc(-c3cccc(C(=O)O)n3)n2)n1
|
| ZINC238950253 ZINC | 0.718 | 744.4 Da LogP -2.90 TPSA 364.8 | 3 viol. | ✓ Clean |
NC(=O)c1ccc[n+]([C@@H]2O[C@H](CO[P@](=O)(O)O[P@…
|
| ZINC238950256 ZINC | 0.718 | 744.4 Da LogP -2.90 TPSA 364.8 | 3 viol. | ✓ Clean |
NC(=O)c1ccc[n+]([C@@H]2O[C@H](CO[P@](=O)(O)O[P@…
|
| ZINC238950259 ZINC | 0.718 | 744.4 Da LogP -2.90 TPSA 364.8 | 3 viol. | ✓ Clean |
NC(=O)c1ccc[n+]([C@@H]2O[C@H](CO[P@](=O)(O)O[P@…
|
| ZINC238950261 ZINC | 0.718 | 744.4 Da LogP -2.90 TPSA 364.8 | 3 viol. | ✓ Clean |
NC(=O)c1ccc[n+]([C@@H]2O[C@H](CO[P@](=O)(O)O[P@…
|
| ZINC331827 ZINC | 0.696 | 202.0 Da LogP 1.54 TPSA 50.2 | ✓ Ro5 | ✓ Clean |
O=C(O)c1cccc(Br)n1
|
| ZINC4352696 ZINC | 0.696 | 249.0 Da LogP 1.38 TPSA 50.2 | ✓ Ro5 | ✓ Clean |
O=C(O)c1cccc(I)n1
|
| ZINC12501520 ZINC | 0.688 | 458.5 Da LogP -0.88 TPSA 123.5 | 1 viol. | ✓ Clean |
OCCOCCOCCOCCOCCOCCOCCOCCOCCOCCO
|
| ZINC3874716 ZINC | 0.688 | 414.5 Da LogP -0.90 TPSA 114.3 | ✓ Ro5 | ✓ Clean |
OCCOCCOCCOCCOCCOCCOCCOCCOCCO
|
| ZINC4283769 ZINC | 0.688 | 238.3 Da LogP -0.96 TPSA 77.4 | ✓ Ro5 | ✓ Clean |
OCCOCCOCCOCCOCCO
|
| ZINC4521548 ZINC | 0.688 | 282.3 Da LogP -0.95 TPSA 86.6 | ✓ Ro5 | ✓ Clean |
OCCOCCOCCOCCOCCOCCO
|
| ZINC5178829 ZINC | 0.688 | 326.4 Da LogP -0.93 TPSA 95.8 | ✓ Ro5 | ✓ Clean |
OCCOCCOCCOCCOCCOCCOCCO
|
| ZINC5178830 ZINC | 0.688 | 370.4 Da LogP -0.91 TPSA 105.1 | ✓ Ro5 | ✓ Clean |
OCCOCCOCCOCCOCCOCCOCCOCCO
|
| ZINC5859031 ZINC | 0.688 | 294.4 Da LogP 1.13 TPSA 55.4 | ✓ Ro5 | ✓ Clean |
CCOCCOCCOCCOCCOCCOCC
|
| ZINC308666757 ZINC | 0.680 | 219.1 Da LogP 1.52 TPSA 67.3 | ✓ Ro5 | ✓ Clean |
O=C(O)c1cccc(C(=O)C(F)(F)F)n1
|
| ZINC105377 ZINC | 0.667 | 238.0 Da LogP 1.58 TPSA 50.4 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(I)o1
|
| ZINC98175528 ZINC | 0.640 | 240.5 Da LogP 2.61 TPSA 50.2 | ✓ Ro5 | ✓ Clean |
O=C(O)c1cccc(C(Cl)(Cl)Cl)n1
|
| ZINC517765 ZINC | 0.636 | 236.2 Da LogP 1.86 TPSA 100.9 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(Cc2ccc(C(=O)O)o2)o1
|
| ZINC34563915 ZINC | 0.630 | 222.2 Da LogP 1.26 TPSA 70.5 | ✓ Ro5 | ✓ Clean |
CCN(CC)C(=O)c1cccc(C(=O)O)n1
|
| ZINC36756657 ZINC | 0.630 | 220.2 Da LogP 1.02 TPSA 70.5 | ✓ Ro5 | ✓ Clean |
O=C(O)c1cccc(C(=O)N2CCCC2)n1
|
| ZINC12360002 ZINC | 0.627 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CO[P@@](=O)(O)OP(=O…
|
| ZINC12360703 ZINC | 0.627 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CO[P@@](=O)(O)OP(=O…
|
| ZINC12503599 ZINC | 0.627 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CO[P@@](=O)(O)OP(=O…
|
| ZINC16546165 ZINC | 0.627 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@H](CO[P@](=O)(O)OP(=O)(…
|
| ZINC31977053 ZINC | 0.627 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](CO[P@](=O)(O)OP(=O)…
|
| ZINC4806433 ZINC | 0.627 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CO[P@@](=O)(O)OP(=O…
|
| ZINC53683898 ZINC | 0.627 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](CO[P@@](=O)(O)OP(=…
|
| ZINC8586019 ZINC | 0.627 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](CO[P@](=O)(O)OP(=O)…
|
| ZINC8586020 ZINC | 0.627 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](CO[P@@](=O)(O)OP(=…
|
| ZINC8586021 ZINC | 0.627 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](CO[P@@](=O)(O)OP(=O…
|
| ZINC8586022 ZINC | 0.627 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](CO[P@@](=O)(O)OP(=…
|
| ZINC1644613 ZINC | 0.619 | 206.3 Da LogP 0.83 TPSA 47.9 | ✓ Ro5 | ✓ Clean |
CCCCOCCOCCOCCO
|
| ZINC145462956 ZINC | 0.615 | 240.3 Da LogP 2.32 TPSA 59.9 | ✓ Ro5 | ✓ Clean |
O=C(CCC(=O)c1ccccn1)c1ccccn1
|
| ZINC2566954 ZINC | 0.615 | 203.2 Da LogP 0.03 TPSA 104.6 | ✓ Ro5 | ✓ Clean |
O=C(O)c1cccc(S(=O)(=O)O)n1
|
| ZINC134079 ZINC | 0.611 | 242.2 Da LogP 2.75 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(-c2ccc(C(=O)O)cc2)cc1
|
| ZINC1542984515 ZINC | 0.609 | 408.3 Da LogP 4.56 TPSA 151.3 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(-c2cc(-c3ccc(C(=O)O)o3)cc(-c3ccc(C(…
|
| ZINC174780 ZINC | 0.607 | 209.2 Da LogP 1.34 TPSA 76.5 | ✓ Ro5 | ✓ Clean |
CC(C)OC(=O)c1cccc(C(=O)O)n1
|
| ZINC21161893 ZINC | 0.607 | 223.2 Da LogP 1.74 TPSA 76.5 | ✓ Ro5 | ✓ Clean |
CC(C)(C)OC(=O)c1cccc(C(=O)O)n1
|
| ZINC218535275 ZINC | 0.607 | 224.2 Da LogP -0.41 TPSA 116.6 | ✓ Ro5 | ✓ Clean |
O=C(O)CNC(=O)c1cccc(C(=O)O)n1
|
| ZINC36756666 ZINC | 0.607 | 208.2 Da LogP 0.92 TPSA 79.3 | ✓ Ro5 | ✓ Clean |
CC(C)NC(=O)c1cccc(C(=O)O)n1
|
| ZINC1580161 ZINC | 0.600 | 208.3 Da LogP -0.33 TPSA 57.2 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCO
|
| ZINC16052118 ZINC | 0.600 | 340.4 Da LogP -0.28 TPSA 84.8 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOCCOCCOCCO
|
| ZINC16052257 ZINC | 0.600 | 384.5 Da LogP -0.26 TPSA 94.1 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOCCOCCOCCOCCO
|
| ZINC34317654 ZINC | 0.600 | 472.6 Da LogP -0.23 TPSA 112.5 | 1 viol. | ✓ Clean |
COCCOCCOCCOCCOCCOCCOCCOCCOCCOCCO
|
| ZINC5997860 ZINC | 0.600 | 296.4 Da LogP -0.29 TPSA 75.6 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOCCOCCO
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.