KpATCC43816 Protein target profile

citrate (pro-3S)-lyase, beta subunit

Accession: VK055_2539

Gene: AIK81136.1 citE 3D evidence: AlphaFold DB model + ColabFold model Metabolism 3 reactions UniProt A0A0H3GRI7
Length 283
Pocket druggability (P2Rank · AlphaFold DB model) 0.608
Metabolic reactions 3
Chokepoint Yes
Direct ligand evidence 0 36 total records
Functional annotation 0 EC 5 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
31.313 Lower values reduce human off-target concern.
Human E-value
1.87e-14
Gut microbiome similarity
5.0% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
64.211 Higher values support similarity to known essential genes.
DEG E-value
9.31e-125 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
95.99 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.608
Structure A0A0H3GRI7
Pocket Pocket 1
Druggability (FPocket) 0.506
Structure A0A0H3GRI7
Pocket Pocket 16
ColabFold model
P2Rank 0.587 · Pocket 1
FPocket 0.6 · Pocket 3
Core conservation Accessory gene
Roary accessory
CoreCruncher accessory
Gut microbiome 235 / 4744 genomes with a hit
Prevalence 5.0%

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

Explore metabolic network

Attractive metabolic target: catalyzes a producing chokepoint reaction, more central than 95.1% of genes in this genome.

Relative network centrality 95.1% more central than 95.1% of genes in this genome
Chokepoint Chokepoint gene
Pathways

No specific KEGG pathway assigned - this reaction either has no KEGG mapping, or only matches a generic overview map with no route-level information.

Catalyzed reactions

3 reactions mapped to this gene in the metabolic model. Open the full network to see each one, with substrates/products and the reaction-reaction map.

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MLFIPGANAAMLSTSFVYGADAVMFDLEDAVSLREKDTARLLVYQALQHPLYQDIETVVRINPLNTPFGLADLEAVVRAGVDMVRLPKTDSKEDIHELEAHVERIERECGREVGSTKLMAAIESALGVVNAVEIARASPRLAAIALAAFDYVMDMGTSRGDGTELFYARCAVLHAARVAGIAAYDVVWSDINNEEGFLAEANLAKNLGFNGKSLVNPRQIELLHQVYAPTRKEVDHALEVIAAAEEAETRGLGVVSLNGKMIDGPIIDHARKVVALSASGIRD

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

5 GO

Subcellular localization

Localization
Cytoplasmic

Gene Ontology (GO)

5
  • GO:0003824 Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
  • GO:0009346 Citrate lyase is a multienzyme complex with three constituents: the alpha subunit, citrate-ACP transferase; the beta subunit, citryl-ACP lyase; and the gamma subunit, an acyl-carrier protein which also carries the prosthetic group components. All three subunits are required for citrate lyase enzyme activity. This enzyme has only been found in bacteria.
  • GO:0006084 The chemical reactions and pathways involving acetyl-CoA, a derivative of coenzyme A in which the sulfhydryl group is acetylated; it is a metabolite derived from several pathways (e.g. glycolysis, fatty acid oxidation, amino-acid catabolism) and is further metabolized by the tricarboxylic acid cycle. It is a key intermediate in lipid and terpenoid biosynthesis.
  • GO:0008816 Catalysis of the reaction: (3S)-citryl-CoA = acetyl-CoA + oxaloacetate.
  • GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

13 records
Show feature table
Start End DB Term Name
1 281 FunFam G3DSA:3.20.20.60:FF:000008 Citrate (Pro-3S)-lyase subunit beta
1 217 Pfam PF03328 HpcH/HpaI aldolase/citrate lyase family
1 217 InterPro IPR005000 HpcH/HpaI aldolase/citrate lyase domain
1 227 SUPERFAMILY SSF51621 Phosphoenolpyruvate/pyruvate domain
1 227 InterPro IPR015813 Pyruvate/Phosphoenolpyruvate kinase-like domain superfamily
88 108 Coils Coil Coil
1 280 Gene3D G3DSA:3.20.20.60 -
1 280 InterPro IPR040442 Pyruvate kinase-like domain superfamily
1 277 PANTHER PTHR32308 LYASE BETA SUBUNIT, PUTATIVE (AFU_ORTHOLOGUE AFUA_4G13030)-RELATED
1 283 PIRSF PIRSF015582 Cit_lyase_B
1 283 InterPro IPR011206 Citrate lyase beta subunit-like
1 281 NCBIfam TIGR01588 citrate (pro-3S)-lyase subunit beta
1 281 InterPro IPR006475 Citrate lyase, beta subunit, bacteria

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.608
Likely same site as FPocket 3 2.2 Å 12 shared residues 80% of smaller site
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.125
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.039
Likely same site as FPocket 16 3.5 Å 10 shared residues 100% of smaller site
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #16
0.506 Unusual size
Likely same site as P2Rank 3 3.5 Å 10 shared residues 100% of smaller site
Show in viewer
Surrounding area
Pocket 2 FPocket #3
0.301 Unusual size
Likely same site as P2Rank 1 2.2 Å 12 shared residues 80% of smaller site
Show in viewer
Surrounding area
Residue sets
UniProt: Binding site:129-129
UniProt: Binding site:156-156
UniProt: Binding site:66-66
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GRI7
AlphaFold DB full sequence Viewing
ColabFold VK055_2539
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

36 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 4 records from similar proteins
Structural ligands 4 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 32 similarity-based ZINC candidates
Best available ligand signal
1VU PDB via homolog 823.6 Da · LogP -0.93 · TPSA 363.6 Open detail RCSB PDB
GLV PDB via homolog Detail RCSB PDB
OAA PDB via homolog Detail RCSB PDB
OXL PDB via homolog Detail RCSB PDB
ZINC1532902 ZINC proposed compound · Tanimoto 0.700 Detail ZINC

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
1VU RCSB PDB Q3J5L6 823.6 Da LogP -0.93 TPSA 363.6 3 viol. ✓ Clean CCC(=O)SCCNC(=O)CCNC(=O)[C@@H](C(C)(C)COP(=O)(O…
GLV RCSB PDB Q3J5L6 74.0 Da LogP -0.73 TPSA 54.4 ✓ Ro5 ✓ Clean C(=O)C(=O)O
OAA RCSB PDB Q9RUZ0 131.1 Da LogP -2.22 TPSA 94.5 ✓ Ro5 ✓ Clean C(C(=O)C(=O)O)C(=O)[O-]
OXL RCSB PDB A7NHT0 88.0 Da LogP -3.51 TPSA 80.3 ✓ Ro5 ✓ Clean C(=O)(C(=O)[O-])[O-]

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.