Strong target candidate with converging metabolic, structural and chemical evidence.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Evidence coverage
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- No hit
- Gut microbiome similarity
- 1.0% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- N
- DEG identity (%)
- 26.556 Higher values support similarity to known essential genes.
Structure confidence
- ColabFold pLDDT
- 97.25 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MKTQVAIIGAGPSGLLLGQLLHNAGIHTVILERQTPQYVLGRIRAGILESGTVDLLREAGVAQRMDAEGLVHHGVEFLFDGQRVPVALSELTDGKSVMVYGQTEVTRDLMAARAASGAPIVYGVSEVAIHDAKSDRPTITYLSEGETCRLECDFIAGCDGFHGVSRQSIPAGILQTYESVWPFGWLGLLADTPPVNPELIYAHHQRGFVLCSQRSLTRSRYYLQVPLSDKVEAWSDERFWQELKSRLPEELASRLVTGHSLEKSIAPLRSFVVEPMQYGRLFLVGDAAHIVPPTGAKGLNLAASDVNYLWRILREYYHRGRSDLLAAYSQLALDRVWKGERFSWFMTRLLHDFPDQNAFDAKMQAADRRYYLGSRAGLTTIAENYVGLPMERVA
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- Cytoplasmic
Enzyme Commission (EC)
1Gene Ontology (GO)
4- GO:0071949 Binding to the oxidized form, FAD, of flavin-adenine dinucleotide, the coenzyme or the prosthetic group of various flavoprotein oxidoreductase enzymes.
- GO:0050660 Binding to FAD, flavin-adenine dinucleotide, the coenzyme or the prosthetic group of various flavoprotein oxidoreductase enzymes, in either the oxidized form, FAD, or the reduced form, FADH2.
- GO:0018659 Catalysis of the reaction: 4-hydroxybenzoate + NADPH + H+ + O2 = protocatechuate + NADP+ + H2O.
- GO:0043639 The chemical reactions and pathways resulting in the breakdown of benzoate, the anion of benzoic acid (benzenecarboxylic acid), a fungistatic compound widely used as a food preservative; it is conjugated to glycine in the liver and excreted as hippuric acid.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 2 | 351 | Gene3D | G3DSA:3.50.50.60 | - |
| 2 | 351 | InterPro | IPR036188 | FAD/NAD(P)-binding domain superfamily |
| 1 | 388 | SUPERFAMILY | SSF51905 | FAD/NAD(P)-binding domain |
| 1 | 388 | InterPro | IPR036188 | FAD/NAD(P)-binding domain superfamily |
| 2 | 342 | Pfam | PF01494 | FAD binding domain |
| 2 | 342 | InterPro | IPR002938 | FAD-binding domain |
| 2 | 329 | PANTHER | PTHR43004 | TRK SYSTEM POTASSIUM UPTAKE PROTEIN |
| 1 | 390 | NCBIfam | TIGR02360 | 4-hydroxybenzoate 3-monooxygenase |
| 1 | 390 | InterPro | IPR012733 | 4-hydroxybenzoate 3-monooxygenase |
| 175 | 275 | SUPERFAMILY | SSF54373 | FAD-linked reductases, C-terminal domain |
| 73 | 388 | Gene3D | G3DSA:3.30.9.10 | - |
| 293 | 309 | PRINTS | PR00420 | Aromatic-ring hydroxylase (flavoprotein monooxygenase) signature |
| 310 | 328 | PRINTS | PR00420 | Aromatic-ring hydroxylase (flavoprotein monooxygenase) signature |
| 4 | 26 | PRINTS | PR00420 | Aromatic-ring hydroxylase (flavoprotein monooxygenase) signature |
| 151 | 166 | PRINTS | PR00420 | Aromatic-ring hydroxylase (flavoprotein monooxygenase) signature |
| 278 | 293 | PRINTS | PR00420 | Aromatic-ring hydroxylase (flavoprotein monooxygenase) signature |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GIS2
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
VK055_2617
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural and bioactivity evidence are both available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| APR RCSB PDB | P00438 | 559.3 Da LogP -3.28 TPSA 291.5 | 3 viol. | ✓ Clean |
c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
|
|
| BHA RCSB PDB | P00438 | 153.1 Da LogP 0.67 TPSA 83.5 | ✓ Ro5 | ✓ Clean |
c1cc(c(cc1N)O)C(=O)O
|
|
| DHB RCSB PDB | P20586 | 154.1 Da LogP 0.80 TPSA 77.8 | ✓ Ro5 | Alert |
c1cc(c(cc1C(=O)O)O)O
|
|
| DOB RCSB PDB | P20586 | 154.1 Da LogP 0.80 TPSA 77.8 | ✓ Ro5 | ✓ Clean |
c1cc(c(cc1O)O)C(=O)O
|
|
| FAS RCSB PDB | P00438 | 785.6 Da LogP -2.42 TPSA 362.9 | 3 viol. | ✓ Clean |
Cc1cc2c(cc1C)N(C3=NC(=O)NC(=O)C3=N2)C[C@H]([C@@…
|
|
| PAB RCSB PDB | P20586 | 137.1 Da LogP 0.97 TPSA 63.3 | ✓ Ro5 | ✓ Clean |
c1cc(ccc1C(=O)O)N
|
|
| PHB RCSB PDB | C4TP09 | 138.1 Da LogP 1.09 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
c1cc(ccc1C(=O)O)O
|
|
| PSL RCSB PDB | P20586 | 176.1 Da LogP -2.08 TPSA 123.6 | ✓ Ro5 | ✓ Clean |
[O-]S(=O)(=O)OS(=O)(=O)[O-]
|
|
| RFH RCSB PDB | Q5YTV5 | 839.0 Da LogP 3.15 TPSA 248.0 | 2 viol. | Alert |
Cc1c(c2c(c3c1O[C@](C3=O)(C)O/C=C/[C@@H]([C@@H](…
|
|
| RFL RCSB PDB | P20586 | 814.6 Da LogP -2.67 TPSA 366.2 | 3 viol. | ✓ Clean |
Cc1cc2c(cc1N(C)C)N(C3=NC(=O)NC(=O)C3=N2)C[C@@H]…
|
|
| RFP RCSB PDB | F2R776 | 823.0 Da LogP 4.34 TPSA 220.1 | 3 viol. | Alert |
Cc1c(c2c3c4c1O[C@@](C4=O)(O\C=C\[C@@H]([C@H]([C…
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
| Ligand | UniProt (homolog) | pchembl | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| CHEMBL130259 ChEMBL | P00438 | 7.23 ~58.9 nM | 244.2 Da LogP 2.67 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(O)cc1OCc1ccccc1
|
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC1245666585 ZINC | 0.850 | 289.3 Da LogP 4.30 TPSA 63.3 | ✓ Ro5 | ✓ Clean |
Nc1ccc(-c2ccc(-c3ccc(C(=O)O)cc3)cc2)cc1
|
| ZINC1746121 ZINC | 0.850 | 213.2 Da LogP 2.63 TPSA 63.3 | ✓ Ro5 | ✓ Clean |
Nc1ccc(-c2ccc(C(=O)O)cc2)cc1
|
| ZINC22018837 ZINC | 0.850 | 241.2 Da LogP 2.20 TPSA 80.4 | ✓ Ro5 | ✓ Clean |
Nc1ccc(C(=O)c2ccc(C(=O)O)cc2)cc1
|
| ZINC389804 ZINC | 0.842 | 214.2 Da LogP 2.76 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(-c2ccc(O)cc2)cc1
|
| ZINC100412109 ZINC | 0.739 | 241.3 Da LogP 3.38 TPSA 88.0 | ✓ Ro5 | Alert |
Nc1ccc(/N=N\c2ccc(C(=O)O)cc2)cc1
|
| ZINC113407075 ZINC | 0.739 | 237.3 Da LogP 2.37 TPSA 63.3 | ✓ Ro5 | ✓ Clean |
Nc1ccc(C#Cc2ccc(C(=O)O)cc2)cc1
|
| ZINC127654 ZINC | 0.739 | 229.2 Da LogP 2.76 TPSA 72.5 | ✓ Ro5 | Alert |
Nc1ccc(Oc2ccc(C(=O)O)cc2)cc1
|
| ZINC1628139 ZINC | 0.739 | 239.3 Da LogP 3.14 TPSA 63.3 | ✓ Ro5 | ✓ Clean |
Nc1ccc(/C=C/c2ccc(C(=O)O)cc2)cc1
|
| ZINC17285708 ZINC | 0.739 | 239.3 Da LogP 3.14 TPSA 63.3 | ✓ Ro5 | ✓ Clean |
Nc1ccc(/C=C\c2ccc(C(=O)O)cc2)cc1
|
| ZINC17322332 ZINC | 0.739 | 241.3 Da LogP 3.38 TPSA 88.0 | ✓ Ro5 | Alert |
Nc1ccc(N=Nc2ccc(C(=O)O)cc2)cc1
|
| ZINC1750451 ZINC | 0.739 | 227.3 Da LogP 2.56 TPSA 63.3 | ✓ Ro5 | Alert |
Nc1ccc(Cc2ccc(C(=O)O)cc2)cc1
|
| ZINC4707411 ZINC | 0.739 | 241.3 Da LogP 3.38 TPSA 88.0 | ✓ Ro5 | Alert |
Nc1ccc(/N=N/c2ccc(C(=O)O)cc2)cc1
|
| ZINC148781474 ZINC | 0.727 | 274.2 Da LogP 2.16 TPSA 115.1 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(-c2ccc(C(=O)O)cc2O)c(O)c1
|
| ZINC33246180 ZINC | 0.727 | 242.2 Da LogP 3.51 TPSA 82.2 | ✓ Ro5 | Alert |
O=C(O)c1ccc(N=Nc2ccc(O)cc2)cc1
|
| ZINC3896282 ZINC | 0.727 | 242.2 Da LogP 3.51 TPSA 82.2 | ✓ Ro5 | Alert |
O=C(O)c1ccc(/N=N/c2ccc(O)cc2)cc1
|
| ZINC392302 ZINC | 0.727 | 230.2 Da LogP 2.88 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(Oc2ccc(O)cc2)cc1
|
| ZINC13084338 ZINC | 0.722 | 242.3 Da LogP 3.27 TPSA 46.5 | ✓ Ro5 | ✓ Clean |
Cc1ccc(C(=O)O)c(OCc2ccccc2)c1
|
| ZINC91297263 ZINC | 0.722 | 246.2 Da LogP 3.10 TPSA 46.5 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(F)cc1OCc1ccccc1
|
| ZINC1675321 ZINC | 0.714 | 274.2 Da LogP 1.57 TPSA 115.1 | ✓ Ro5 | Alert |
O=C(C(=O)c1ccc(O)c(O)c1)c1ccc(O)c(O)c1
|
| ZINC2169206 ZINC | 0.697 | 228.2 Da LogP 2.96 TPSA 46.5 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccccc1OCc1ccccc1
|
| ZINC1587804 ZINC | 0.696 | 274.2 Da LogP 1.57 TPSA 115.1 | ✓ Ro5 | Alert |
O=C(C(=O)c1ccc(O)cc1O)c1ccc(O)cc1O
|
| ZINC289893 ZINC | 0.696 | 278.3 Da LogP 1.92 TPSA 91.7 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(S(=O)(=O)c2ccc(O)cc2)cc1
|
| ZINC39103 ZINC | 0.696 | 246.2 Da LogP 1.74 TPSA 98.0 | ✓ Ro5 | ✓ Clean |
O=C(c1ccc(O)cc1O)c1ccc(O)cc1O
|
| ZINC1710961 ZINC | 0.684 | 240.3 Da LogP 1.92 TPSA 86.2 | ✓ Ro5 | Alert |
Nc1ccc(C(=O)C(=O)c2ccc(N)cc2)cc1
|
| ZINC113749473 ZINC | 0.680 | 261.3 Da LogP 2.37 TPSA 63.3 | ✓ Ro5 | ✓ Clean |
Nc1ccc(C#CC#Cc2ccc(C(=O)O)cc2)cc1
|
| ZINC439984 ZINC | 0.679 | 258.2 Da LogP 2.03 TPSA 94.8 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccccc1C(=O)c1ccc(O)cc1O
|
| ZINC114185151 ZINC | 0.667 | 298.2 Da LogP 2.15 TPSA 108.7 | ✓ Ro5 | Alert |
O=C(O)c1ccc(C(=O)C(=O)c2ccc(C(=O)O)cc2)cc1
|
| ZINC146669761 ZINC | 0.667 | 274.2 Da LogP 2.16 TPSA 115.1 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(-c2ccc(C(=O)O)c(O)c2)cc1O
|
| ZINC2049383980 ZINC | 0.667 | 286.3 Da LogP 3.75 TPSA 55.8 | ✓ Ro5 | ✓ Clean |
CC(C)Oc1ccc(C(=O)O)c(OCc2ccccc2)c1
|
| ZINC2924369 ZINC | 0.667 | 242.2 Da LogP 2.16 TPSA 74.6 | ✓ Ro5 | Alert |
O=C(C(=O)c1ccc(O)cc1)c1ccc(O)cc1
|
| ZINC90712706 ZINC | 0.667 | 306.4 Da LogP 4.55 TPSA 38.7 | ✓ Ro5 | ✓ Clean |
Oc1ccc(OCc2ccccc2)c(OCc2ccccc2)c1
|
| ZINC95830239 ZINC | 0.667 | 296.2 Da LogP 3.98 TPSA 46.5 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(C(F)(F)F)cc1OCc1ccccc1
|
| ZINC225984 ZINC | 0.654 | 256.3 Da LogP 2.22 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
Nc1ccc(C(=O)Nc2ccc(C(=O)O)cc2)cc1
|
| ZINC32303064 ZINC | 0.654 | 256.3 Da LogP 2.22 TPSA 92.4 | ✓ Ro5 | Alert |
Nc1ccc(NC(=O)c2ccc(C(=O)O)cc2)cc1
|
| ZINC155329 ZINC | 0.650 | 212.3 Da LogP 2.08 TPSA 69.1 | ✓ Ro5 | ✓ Clean |
Nc1ccc(C(=O)c2ccc(N)cc2)cc1
|
| ZINC1587673 ZINC | 0.650 | 273.2 Da LogP 2.87 TPSA 89.7 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc([N+](=O)[O-])cc1OCc1ccccc1
|
| ZINC35414218 ZINC | 0.650 | 286.3 Da LogP 3.75 TPSA 55.8 | ✓ Ro5 | ✓ Clean |
CCCOc1ccc(C(=O)O)c(OCc2ccccc2)c1
|
| ZINC310032990 ZINC | 0.649 | 264.2 Da LogP 3.24 TPSA 46.5 | ✓ Ro5 | ✓ Clean |
O=C(O)c1cc(F)c(F)cc1OCc1ccccc1
|
| ZINC396144916 ZINC | 0.649 | 256.3 Da LogP 3.58 TPSA 46.5 | ✓ Ro5 | ✓ Clean |
Cc1cc(OCc2ccccc2)c(C(=O)O)cc1C
|
| ZINC12471554 ZINC | 0.640 | 217.0 Da LogP 1.85 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(Br)c(O)c1
|
| ZINC161925 ZINC | 0.640 | 264.0 Da LogP 1.69 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(I)c(O)c1
|
| ZINC2048532660 ZINC | 0.640 | 350.3 Da LogP 3.83 TPSA 115.1 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(-c2ccc(-c3ccc(C(=O)O)c(O)c3)cc2)cc1O
|
| ZINC2566180 ZINC | 0.640 | 217.0 Da LogP 1.85 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(O)c(Br)c1
|
| ZINC3156317 ZINC | 0.640 | 258.2 Da LogP 2.31 TPSA 83.8 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(OC(=O)c2ccc(O)cc2)cc1
|
| ZINC330968 ZINC | 0.640 | 264.0 Da LogP 1.69 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(O)c(I)c1
|
| ZINC4903179 ZINC | 0.640 | 257.2 Da LogP 2.34 TPSA 86.6 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(NC(=O)c2ccc(O)cc2)cc1
|
| ZINC6535079 ZINC | 0.640 | 204.2 Da LogP 1.95 TPSA 77.8 | ✓ Ro5 | Alert |
O=C(O)c1ccc2cc(O)c(O)cc2c1
|
| ZINC72107312 ZINC | 0.639 | 244.2 Da LogP 2.67 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
O=C(O)c1cccc(OCc2ccccc2)c1O
|
| ZINC2026240 ZINC | 0.636 | 225.2 Da LogP 2.33 TPSA 60.2 | ✓ Ro5 | Alert |
Nc1ccc(C(=O)C(=O)c2ccccc2)cc1
|
| ZINC239025565 ZINC | 0.634 | 695.8 Da LogP 3.63 TPSA 195.0 | 2 viol. | Alert |
CO[C@@H]1/C=C/O[C@@]2(C)Oc3c(C)c(O)c4c(c3C2=O)C…
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.