Protein target profile

VK055_2682

glutathione transferase fosA

Genome: KpATCC43816 Gene: AIK81276.1 fosA 3D evidence: Experimental + ColabFold model Metabolism 2 reactions UniProt A0A0H3GM04|W8UNW6
Length 139
Pocket druggability 0.53
Metabolic reactions 2
Chokepoint Yes
Direct ligand evidence 0 26 total records
Functional annotation 0 EC 0 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
1.2% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
29.008 Higher values support similarity to known essential genes.

Localization

Localization
Cytoplasmic

Structure confidence

ColabFold pLDDT
97.34 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

PDB experimental structure

The selected pocket score is the FPocket value used for ranking after applying the curated structure priority. It estimates small-molecule pocket quality; it is not experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

FPocket 0.53
Structure 5V3D
Pocket Pocket 1
P2Rank 0.335
Structure 6C3U
Pocket Pocket 1
ColabFold model
FPocket 0.503 · Pocket 1
P2Rank 0.154 · Pocket 1
Core conservation Accessory gene
Roary core
CoreCruncher accessory
Gut microbiome 56 / 4744 genomes with a hit
Prevalence 1.2%

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

Explore metabolic network

Attractive metabolic target: catalyzes a producing chokepoint reaction, no human homolog detected.

Relative network centrality 0.0% more central than 0.0% of genes in this genome
Chokepoint Chokepoint gene
Pathways

No specific KEGG pathway assigned - this reaction either has no KEGG mapping, or only matches a generic overview map with no route-level information.

Catalyzed reactions

2 reactions mapped to this gene in the metabolic model. Open the full network to see each one, with substrates/products and the reaction-reaction map.

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MLSGLNHLTLAVSQLAPSVAFYQQLLGMTLHARWDSGAYLSCGDLWLCLSLDPQRRVTPPEESDYTHYAFSISEADFASFAARLEAAGVAIWKLNRSEGASHYFLDPDGHKLELHVGSLAQRLAACREQPYKGMVFFDQ

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

No GO or EC annotations are currently loaded for this protein.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

10 records
Show feature table
Start End DB Term Name
1 139 Gene3D G3DSA:3.10.180.10 -
1 139 InterPro IPR029068 Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase
4 114 Pfam PF00903 Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily
4 114 InterPro IPR004360 Glyoxalase/fosfomycin resistance/dioxygenase domain
1 136 SUPERFAMILY SSF54593 Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase
1 136 InterPro IPR029068 Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase
4 128 CDD cd07244 FosA
4 117 ProSiteProfiles PS51819 Vicinal oxygen chelate (VOC) domain profile.
4 117 InterPro IPR037523 Vicinal oxygen chelate (VOC) domain
2 115 PANTHER PTHR21366 GLYOXALASE FAMILY PROTEIN

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · FPocket

Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Site 1 FPocket #1
0.53
Unusual size
Show in viewer
Surrounding area
All structural evidence 5 experimental · 1 predicted

Structural evidence

5 + 1

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
PDB 5V3D
X-ray A Viewing
PDB 5V91
X-ray A Loaded
PDB 5WEW
X-ray A Loaded
PDB 6C3U
X-ray A Loaded
PDB 8R37
X-ray A Loaded
ColabFold VK055_2682
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

26 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 6 records from similar proteins
Structural ligands 6 3 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 20 similarity-based ZINC candidates
Best available ligand signal
1KM PDB via homolog 259.2 Da · LogP -0.98 · TPSA 141.1 Open detail RCSB PDB
A81 PDB via homolog Detail RCSB PDB
FCN PDB via homolog Detail RCSB PDB
NY2 PDB via homolog Detail RCSB PDB
PPF PDB via homolog Detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
1KM RCSB PDB Q739M9 259.2 Da LogP -0.98 TPSA 141.1 ✓ Ro5 ✓ Clean C[C@@H]([C@H](P(=O)(O)O)SC[C@@H](C(=O)O)N)O
A81 RCSB PDB W8UNW6 537.1 Da LogP 1.85 TPSA 172.1 1 viol. ✓ Clean C1=C(C=NC2=C(C(=O)NN21)Br)c3c(c(n[nH]3)C4=CN5C(…
FCN RCSB PDB W8UNW6 138.1 Da LogP -0.09 TPSA 70.1 ✓ Ro5 ✓ Clean C[C@H]1[C@H](O1)P(=O)(O)O
NY2 RCSB PDB A0A0H3GM04 325.1 Da LogP 1.08 TPSA 122.0 ✓ Ro5 ✓ Clean c1c(c(n[nH]1)C2=CN3C(=C(C(=O)N3)Br)N=C2)[N+](=O…
PPF RCSB PDB Q9I4K6 126.0 Da LogP -0.16 TPSA 94.8 ✓ Ro5 ✓ Clean C(=O)(O)P(=O)(O)O
TL RCSB PDB Q9I4K6 204.4 Da LogP -0.38 TPSA 0.0 ✓ Ro5 ✓ Clean [Tl+]

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.