Target candidate with partial support; inspect missing evidence before prioritizing.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- Hit
- Human identity (%)
- 70.732 Lower values reduce human off-target concern.
- Human E-value
- 3.01e-41
- Gut microbiome similarity
- 3.8% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- N
- DEG identity (%)
- 0.0 Higher values support similarity to known essential genes.
Localization
- Localization
- Unknown
Structure confidence
- ColabFold pLDDT
- 95.54 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelThe selected pocket score is the FPocket value used for ranking after applying the curated structure priority. It estimates small-molecule pocket quality; it is not experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.
Sequence
Sequence
Primary amino-acid sequence viewer.
MSLFDKTHLVAQADALPGRNTPMPVATLHAVNGHSMTNVPAGMEVALFAMGCFWGVERLFWQLPGVYSTAAGYTGGYTPNPTYREVCSGQTGHAEAVRVVYDPQVISYEQLLQVFWENHDPAQGMRQGNDHGTQYRSAIYPLTPEQTEAAKASLARFQAAMNDAHDTRHITTEIATAKPFYYAEDDHQQYLYKNPHGYCGIGGIGVCLPPQA
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Enzyme Commission (EC)
1Gene Ontology (GO)
4- GO:0008113 Catalysis of the reaction: L-methionyl-[protein] + [thioredoxin]-disulfide + H2O = L-methionyl-(S)-S-oxide-[protein] + [thioredoxin]-dithiol.
- GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
- GO:0033744 Catalysis of the reaction: [thioredoxin]-disulfide + L-methionine + H2O = L-methionine (S)-S-oxide + [thioredoxin]-dithiol.
- GO:0034599 Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of oxidative stress, a state often resulting from exposure to high levels of reactive oxygen species, e.g. superoxide anions, hydrogen peroxide (H2O2), and hydroxyl radicals.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 4 | 212 | FunFam | G3DSA:3.30.1060.10:FF:000001 | Peptide methionine sulfoxide reductase MsrA |
| 46 | 199 | Pfam | PF01625 | Peptide methionine sulfoxide reductase |
| 46 | 199 | InterPro | IPR002569 | Peptide methionine sulphoxide reductase MsrA domain |
| 45 | 199 | NCBIfam | TIGR00401 | peptide-methionine (S)-S-oxide reductase MsrA |
| 45 | 199 | InterPro | IPR002569 | Peptide methionine sulphoxide reductase MsrA domain |
| 4 | 211 | Gene3D | G3DSA:3.30.1060.10 | Peptide methionine sulphoxide reductase MsrA |
| 4 | 211 | InterPro | IPR036509 | Peptide methionine sulphoxide reductase MsrA superfamily |
| 43 | 205 | Hamap | MF_01401 | Peptide methionine sulfoxide reductase MsrA [msrA]. |
| 43 | 205 | InterPro | IPR002569 | Peptide methionine sulphoxide reductase MsrA domain |
| 37 | 200 | PANTHER | PTHR42799 | MITOCHONDRIAL PEPTIDE METHIONINE SULFOXIDE REDUCTASE |
| 5 | 208 | SUPERFAMILY | SSF55068 | Peptide methionine sulfoxide reductase |
| 5 | 208 | InterPro | IPR036509 | Peptide methionine sulphoxide reductase MsrA superfamily |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Residue sets
Binding pockets · FPocket
Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Residue sets
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GHE5
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
VK055_2849
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural and bioactivity evidence are both available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| CAC RCSB PDB | Q6NEL2 | 137.0 Da LogP -0.52 TPSA 40.1 | ✓ Ro5 | ✓ Clean |
C[As](=O)(C)[O-]
|
|
| D1D RCSB PDB | Q73PT7 | 152.2 Da LogP 0.10 TPSA 40.5 | ✓ Ro5 | ✓ Clean |
C1[C@H]([C@@H](CSS1)O)O
|
|
| DTT RCSB PDB | Q73PT7 | 154.3 Da LogP -0.43 TPSA 40.5 | ✓ Ro5 | ✓ Clean |
C([C@@H]([C@H](CS)O)O)S
|
|
| MYR RCSB PDB | Q9D6Y7 | 228.4 Da LogP 4.77 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCC(=O)O
|
|
| RSM RCSB PDB | Q9JWM8 | 220.3 Da LogP -0.99 TPSA 75.3 | ✓ Ro5 | ✓ Clean |
CC(=O)N[C@@H](CC[S@](=O)C)C(=O)NC
|
|
| SSM RCSB PDB | Q9JWM8 | 220.3 Da LogP -0.99 TPSA 75.3 | ✓ Ro5 | ✓ Clean |
CC(=O)N[C@@H](CC[S@@](=O)C)C(=O)NC
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
| Ligand | UniProt (homolog) | pchembl | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| CHEMBL1350983 ChEMBL | P54149 | — | 246.0 Da LogP -1.05 TPSA 94.8 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccccc1[As](=O)(O)O
|
| CHEMBL1445776 ChEMBL | P54149 | — | 360.4 Da LogP 2.01 TPSA 77.3 | ✓ Ro5 | Alert |
O=C1C(N2CCOCC2)=C(n2nnc3ccccc32)C(=O)c2ccccc21
|
| CHEMBL1563172 ChEMBL | P54149 | — | 385.2 Da LogP 0.46 TPSA 154.3 | ✓ Ro5 | Alert |
CSc1nc(N)c(N=Nc2ccc([As](=O)(O)O)cc2)c(O)n1
|
| CHEMBL1877709 ChEMBL | P54149 | — | 438.5 Da LogP 3.82 TPSA 112.9 | ✓ Ro5 | Alert |
O=C(O)c1ccc(NC2=C/C(=N/S(=O)(=O)c3cccs3)c3ccccc…
|
| CHEMBL1998302 ChEMBL | P54149 | — | 432.5 Da LogP 3.76 TPSA 112.9 | ✓ Ro5 | Alert |
O=C(O)c1ccc(NC2=C/C(=N/S(=O)(=O)c3ccccc3)c3cccc…
|
| CHEMBL3195410 ChEMBL | P54149 | — | 460.5 Da LogP 4.32 TPSA 112.9 | ✓ Ro5 | Alert |
CCc1ccc(S(=O)(=O)/N=C2\C=C(Nc3ccc(C(=O)O)cc3)C(…
|
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC100432688 ZINC | 1.000 | 432.5 Da LogP 3.76 TPSA 112.9 | ✓ Ro5 | Alert |
O=C(O)c1ccc(NC2=C/C(=N/S(=O)(=O)c3ccccc3)c3cccc…
|
| ZINC100610914 ZINC | 1.000 | 438.5 Da LogP 3.82 TPSA 112.9 | ✓ Ro5 | Alert |
O=C(O)c1ccc(NC2=C/C(=N/S(=O)(=O)c3cccs3)c3ccccc…
|
| ZINC12501520 ZINC | 1.000 | 458.5 Da LogP -0.88 TPSA 123.5 | 1 viol. | ✓ Clean |
OCCOCCOCCOCCOCCOCCOCCOCCOCCOCCO
|
| ZINC1282589 ZINC | 1.000 | 360.4 Da LogP 2.01 TPSA 77.3 | ✓ Ro5 | Alert |
O=C1C(N2CCOCC2)=C(n2nnc3ccccc32)C(=O)c2ccccc21
|
| ZINC1529498 ZINC | 1.000 | 200.3 Da LogP 3.99 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCC(=O)O
|
| ZINC1530417 ZINC | 1.000 | 228.4 Da LogP 4.77 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCC(=O)O
|
| ZINC1628119 ZINC | 1.000 | 214.3 Da LogP 4.38 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCC(=O)O
|
| ZINC3874716 ZINC | 1.000 | 414.5 Da LogP -0.90 TPSA 114.3 | ✓ Ro5 | ✓ Clean |
OCCOCCOCCOCCOCCOCCOCCOCCOCCO
|
| ZINC4283769 ZINC | 1.000 | 238.3 Da LogP -0.96 TPSA 77.4 | ✓ Ro5 | ✓ Clean |
OCCOCCOCCOCCOCCO
|
| ZINC4521548 ZINC | 1.000 | 282.3 Da LogP -0.95 TPSA 86.6 | ✓ Ro5 | ✓ Clean |
OCCOCCOCCOCCOCCOCCO
|
| ZINC5178829 ZINC | 1.000 | 326.4 Da LogP -0.93 TPSA 95.8 | ✓ Ro5 | ✓ Clean |
OCCOCCOCCOCCOCCOCCOCCO
|
| ZINC5178830 ZINC | 1.000 | 370.4 Da LogP -0.91 TPSA 105.1 | ✓ Ro5 | ✓ Clean |
OCCOCCOCCOCCOCCOCCOCCOCCO
|
| ZINC100822378 ZINC | 0.854 | 466.9 Da LogP 4.41 TPSA 112.9 | ✓ Ro5 | Alert |
O=C(O)c1ccc(NC2=C/C(=N/S(=O)(=O)c3ccc(Cl)cc3)c3…
|
| ZINC102629392 ZINC | 0.854 | 450.4 Da LogP 3.89 TPSA 112.9 | ✓ Ro5 | Alert |
O=C(O)c1ccc(NC2=C/C(=N/S(=O)(=O)c3ccc(F)cc3)c3c…
|
| ZINC102629400 ZINC | 0.854 | 446.5 Da LogP 4.06 TPSA 112.9 | ✓ Ro5 | Alert |
Cc1ccc(S(=O)(=O)/N=C2/C=C(Nc3ccc(C(=O)O)cc3)C(=…
|
| ZINC138457918 ZINC | 0.850 | 228.3 Da LogP 3.56 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCC(=O)CCCCC(=O)O
|
| ZINC138458029 ZINC | 0.850 | 228.3 Da LogP 3.56 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCCC(=O)CCCCCC(=O)O
|
| ZINC144395054 ZINC | 0.850 | 242.4 Da LogP 3.95 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCC(=O)CCCCCCCC(=O)O
|
| ZINC14619628 ZINC | 0.850 | 270.4 Da LogP 4.73 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCC(=O)CCCCCCCCCC(=O)O
|
| ZINC196749828 ZINC | 0.850 | 214.3 Da LogP 3.17 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCCC(=O)CCCCC(=O)O
|
| ZINC2113934076 ZINC | 0.850 | 256.4 Da LogP 4.34 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCCC(=O)CCCCCCCC(=O)O
|
| ZINC2113934082 ZINC | 0.850 | 256.4 Da LogP 4.34 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCC(=O)CCCCCCC(=O)O
|
| ZINC2113934083 ZINC | 0.850 | 256.4 Da LogP 4.34 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCC(=O)CCCCC(=O)O
|
| ZINC2243670 ZINC | 0.850 | 228.3 Da LogP 3.56 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCC(=O)CCCCCCC(=O)O
|
| ZINC2569203 ZINC | 0.850 | 214.3 Da LogP 3.17 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCC(=O)CCCCCC(=O)O
|
| ZINC4798470 ZINC | 0.850 | 270.4 Da LogP 4.73 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCCC(=O)CCCCCCCCC(=O)O
|
| ZINC5973005 ZINC | 0.850 | 242.4 Da LogP 3.95 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCCC(=O)CCCCCCC(=O)O
|
| ZINC71418182 ZINC | 0.850 | 270.4 Da LogP 4.73 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCC(=O)CCCCC(=O)O
|
| ZINC79244776 ZINC | 0.850 | 270.4 Da LogP 4.73 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCC(=O)CCCCCCCC(=O)O
|
| ZINC86037082 ZINC | 0.850 | 270.4 Da LogP 4.73 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCC(=O)CCCCCC(=O)O
|
| ZINC86037089 ZINC | 0.850 | 270.4 Da LogP 4.73 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCCC(=O)CCCCCCC(=O)O
|
| ZINC86039283 ZINC | 0.850 | 242.4 Da LogP 3.95 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCCC(=O)CCCCC(=O)O
|
| ZINC100919209 ZINC | 0.837 | 490.5 Da LogP 3.54 TPSA 139.2 | ✓ Ro5 | Alert |
COC(=O)c1ccc(NC2=C/C(=N/S(=O)(=O)c3ccc(C(=O)O)c…
|
| ZINC100822310 ZINC | 0.830 | 452.5 Da LogP 3.91 TPSA 101.9 | ✓ Ro5 | Alert |
COC(=O)c1ccc(NC2=C/C(=N/S(=O)(=O)c3cccs3)c3cccc…
|
| ZINC100822381 ZINC | 0.820 | 460.5 Da LogP 4.32 TPSA 112.9 | ✓ Ro5 | Alert |
CCc1ccc(S(=O)(=O)/N=C2/C=C(Nc3ccc(C(=O)O)cc3)C(…
|
| ZINC102919871 ZINC | 0.820 | 474.5 Da LogP 4.88 TPSA 112.9 | ✓ Ro5 | Alert |
CC(C)c1ccc(S(=O)(=O)/N=C2/C=C(Nc3ccc(C(=O)O)cc3…
|
| ZINC16873016 ZINC | 0.820 | 460.5 Da LogP 4.32 TPSA 112.9 | ✓ Ro5 | Alert |
CCc1ccc(S(=O)(=O)N=C2C=C(Nc3ccc(C(=O)O)cc3)C(=O…
|
| ZINC3160730 ZINC | 0.810 | 214.3 Da LogP 3.17 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCC(=O)CCCC(=O)O
|
| ZINC4582907 ZINC | 0.810 | 200.3 Da LogP 2.78 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCCC(=O)CCCC(=O)O
|
| ZINC4727003 ZINC | 0.810 | 312.4 Da LogP 4.69 TPSA 71.4 | ✓ Ro5 | ✓ Clean |
CCCCCCC(=O)CCC(=O)CCCCCCCC(=O)O
|
| ZINC86037074 ZINC | 0.810 | 270.4 Da LogP 4.73 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCC(=O)CCCC(=O)O
|
| ZINC102205938 ZINC | 0.804 | 462.5 Da LogP 3.76 TPSA 122.1 | ✓ Ro5 | Alert |
COc1ccc(S(=O)(=O)/N=C2/C=C(Nc3ccc(C(=O)O)cc3)C(…
|
| ZINC100822394 ZINC | 0.800 | 438.5 Da LogP 3.82 TPSA 112.9 | ✓ Ro5 | Alert |
O=C(O)c1cccc(NC2=C/C(=N/S(=O)(=O)c3cccs3)c3cccc…
|
| ZINC2378801 ZINC | 0.800 | 200.3 Da LogP 2.78 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCC(=O)CCCCC(=O)O
|
| ZINC100478511 ZINC | 0.788 | 410.5 Da LogP 3.82 TPSA 95.8 | ✓ Ro5 | Alert |
O=C1C(Nc2ccc(O)cc2)=C/C(=N/S(=O)(=O)c2cccs2)c2c…
|
| ZINC103721003 ZINC | 0.784 | 482.5 Da LogP 4.91 TPSA 112.9 | ✓ Ro5 | Alert |
O=C(O)c1ccc(NC2=C/C(=N/S(=O)(=O)c3ccc4ccccc4c3)…
|
| ZINC102930303 ZINC | 0.783 | 404.4 Da LogP 3.76 TPSA 95.8 | ✓ Ro5 | Alert |
O=C1C(Nc2ccc(O)cc2)=C/C(=N/S(=O)(=O)c2ccccc2)c2…
|
| ZINC102920855 ZINC | 0.776 | 432.5 Da LogP 3.76 TPSA 112.9 | ✓ Ro5 | Alert |
O=C(O)c1cccc(NC2=C/C(=N/S(=O)(=O)c3ccccc3)c3ccc…
|
| ZINC2697774 ZINC | 0.773 | 435.5 Da LogP 3.50 TPSA 71.3 | ✓ Ro5 | Alert |
O=C1C(N2CCN(c3ccccc3)CC2)=C(n2nnc3ccccc32)C(=O)…
|
| ZINC100919212 ZINC | 0.769 | 460.5 Da LogP 4.37 TPSA 112.9 | ✓ Ro5 | Alert |
Cc1ccc(NC2=C/C(=N/S(=O)(=O)c3ccc(C(=O)O)cc3)c3c…
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.