KpATCC43816 Protein target profile

L-xylulose 5-phosphate 3-epimerase

Accession: VK055_2873

Gene: AIK81462.1 3D evidence: AlphaFold DB model + ColabFold model Metabolism 1 reaction UniProt A0A0H3GHC9
Length 284
Pocket druggability (P2Rank · AlphaFold DB model) 0.796
Metabolic reactions 1
Chokepoint Yes
Direct ligand evidence 0 54 total records
Functional annotation 0 EC 4 GO
Target summary

Strong target candidate with converging metabolic, structural and chemical evidence.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
2.5% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
0.0 Higher values support similarity to known essential genes.

Structure confidence

ColabFold pLDDT
96.46 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.796
Structure A0A0H3GHC9
Pocket Pocket 1
Druggability (FPocket) 0.515
Structure A0A0H3GHC9
Pocket Pocket 2
ColabFold model
P2Rank 0.747 · Pocket 1
FPocket 0.493 · Pocket 3
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 117 / 4744 genomes with a hit
Prevalence 2.5%

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

Explore metabolic network

Attractive metabolic target: catalyzes a consuming chokepoint reaction in Ascorbate and aldarate metabolism, no isoenzyme backup detected, more central than 90.8% of genes in this genome, no human homolog detected.

Relative network centrality 90.8% more central than 90.8% of genes in this genome
Chokepoint Chokepoint gene
Catalyzed reaction

1 reaction mapped to this gene in the metabolic model. Open the full network to see each one, with substrates/products and the reaction-reaction map.

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MLAKSIPLGIYEKALPAGECWLERLKLAKALGFDFVEMSLDETDARLARLDWSPEQRLALVKAVAETGVRVPSMCLSAHRRFPLGSEDDAVRHQGLEIMRKAIQLAQDVGIRVIQLAGYDVYYQQANDETRRRFRDGLKQSVEMASRAQVTLAMEIMDYPLMNSISKALGYAHYLNNPWFQLYPDIGNLSAWDNDVQMELKAGSGHIVAVHVKDTKPGVFKNVPFGEGVVDFERCFETLKQTGYCGPYLIEMWSETSADPLAEVAKARDWVKARMARAGLMEAA

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

4 GO

Subcellular localization

Localization
Cytoplasmic

Gene Ontology (GO)

4
  • GO:0005975 The chemical reactions and pathways involving carbohydrates, any of a group of organic compounds based of the general formula Cx(H2O)y.
  • GO:0016861 Catalysis of an oxidation-reduction (redox) reaction in which the hydrogen donor and acceptor, which is an aldose or a ketose, are the same molecule, and no oxidized product appears.
  • GO:0034015 Catalysis of the reaction: L-ribulose 5-phosphate = L-xylulose 5-phosphate.
  • GO:0019852 The chemical reactions and pathways involving L-ascorbic acid, (2R)-2-[(1S)-1,2-dihydroxyethyl]-4-hydroxy-5-oxo-2,5-dihydrofuran-3-olate; L-ascorbic acid is vitamin C and has co-factor and anti-oxidant activities in many species.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

9 records
Show feature table
Start End DB Term Name
9 274 PANTHER PTHR43489 ISOMERASE
1 284 Gene3D G3DSA:3.20.20.150 -
1 284 FunFam G3DSA:3.20.20.150:FF:000003 L-ribulose-5-phosphate 3-epimerase UlaE
25 272 Pfam PF01261 Xylose isomerase-like TIM barrel
25 272 InterPro IPR013022 Xylose isomerase-like, TIM barrel domain
5 281 NCBIfam TIGR00542 putative hexulose-6-phosphate isomerase
5 281 InterPro IPR004560 L-ribulose-5-phosphate 3-epimerase
21 278 SUPERFAMILY SSF51658 Xylose isomerase-like
21 278 InterPro IPR036237 Xylose isomerase-like superfamily

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.796
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.089
Likely same site as FPocket 2 0.8 Å 14 shared residues 100% of smaller site
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.012
Show in viewer
Surrounding area
Pocket 4 P2Rank #4
0.002
Show in viewer
Surrounding area
Pocket 5 P2Rank #5
0.001
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #2
0.515
Likely same site as P2Rank 2 0.8 Å 14 shared residues 100% of smaller site
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GHC9
AlphaFold DB full sequence Viewing
ColabFold VK055_2873
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

54 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 5 records from similar proteins
Structural ligands 5 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 49 similarity-based ZINC candidates
Best available ligand signal
FUD PDB via homolog 180.2 Da · LogP -3.38 · TPSA 118.2 Open detail RCSB PDB
FZU PDB via homolog Detail RCSB PDB
LTG PDB via homolog Detail RCSB PDB
PSJ PDB via homolog Detail RCSB PDB
SOL PDB via homolog Detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
FUD RCSB PDB A0A172U6X0 180.2 Da LogP -3.38 TPSA 118.2 ✓ Ro5 ✓ Clean C([C@H]([C@H]([C@@H](C(=O)CO)O)O)O)O
FZU RCSB PDB A0A172U6X0 180.2 Da LogP -3.22 TPSA 110.4 ✓ Ro5 ✓ Clean C1[C@@H]([C@H]([C@H]([C@](O1)(CO)O)O)O)O
LTG RCSB PDB A0A172U6X0 180.2 Da LogP -3.38 TPSA 118.2 ✓ Ro5 ✓ Clean C([C@@H]([C@H]([C@H](C(=O)CO)O)O)O)O
PSJ RCSB PDB A0A172U6X0 180.2 Da LogP -3.38 TPSA 118.2 ✓ Ro5 ✓ Clean C([C@H]([C@H]([C@H](C(=O)CO)O)O)O)O
SOL RCSB PDB A0A172U6X0 180.2 Da LogP -3.38 TPSA 118.2 ✓ Ro5 ✓ Clean C([C@@H]([C@H]([C@@H](C(=O)CO)O)O)O)O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.