KpATCC43816 Protein target profile

3-keto-L-gulonate 6-phosphate decarboxylase

Accession: VK055_2874

Gene: sgaH AIK81463.1 3D evidence: AlphaFold DB model + ColabFold model Metabolism 1 reaction UniProt A0A0H3GQN9
Length 212
Pocket druggability (P2Rank · AlphaFold DB model) 0.889
Metabolic reactions 1
Chokepoint Yes
Direct ligand evidence 0 58 total records
Functional annotation 1 EC 4 GO
Target summary

Strong target candidate with converging metabolic, structural and chemical evidence.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
1.5% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
0.0 Higher values support similarity to known essential genes.

Structure confidence

ColabFold pLDDT
98.11 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.889
Structure A0A0H3GQN9
Pocket Pocket 1
Druggability (FPocket) 0.656
Structure A0A0H3GQN9
Pocket Pocket 5
ColabFold model
P2Rank 0.887 · Pocket 1
FPocket 0.288 · Pocket 5
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 71 / 4744 genomes with a hit
Prevalence 1.5%

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

Explore metabolic network

Attractive metabolic target: catalyzes a producing & consuming chokepoint reaction in Ascorbate and aldarate metabolism, no isoenzyme backup detected, more central than 89.6% of genes in this genome, no human homolog detected.

Relative network centrality 89.6% more central than 89.6% of genes in this genome
Chokepoint Chokepoint gene
Catalyzed reaction

1 reaction mapped to this gene in the metabolic model. Open the full network to see each one, with substrates/products and the reaction-reaction map.

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MLQVALDNQTLASAYETTRLIAEEVDIIEVGTILCVGEGVRAVRDLKALYPHKIVLADAKIADAGKILSRMCFEANADWVTVICCADINTAKGALDVAKEFNGDVQIELTGFWTWEQAQAWREAGIQQVVYHRSRDAQAAGVAWSEADISAIKRLSDMGFKVTVTGGLALEDLPLFAGIPVHVFIAGRSIRDAASPVEAARQFKRSIAQLWG

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 4 GO

Subcellular localization

Localization
Cytoplasmic

Enzyme Commission (EC)

1

Gene Ontology (GO)

4
  • GO:0006207 The chemical reactions and pathways resulting in the formation of pyrimidine nucleobases, 1,3-diazine, organic nitrogenous bases, beginning with the synthesis of a pyrimidine ring from simpler precursors.
  • GO:0004590 Catalysis of the reaction: H+ + orotidine 5'-phosphate = CO2 + UMP.
  • GO:0033982 Catalysis of the reaction: 3-dehydro-L-gulonate 6-phosphate + H+ = L-xylulose 5-phosphate + CO2.
  • GO:0019854 The chemical reactions and pathways resulting in the breakdown of L-ascorbic acid; L-ascorbic acid ionizes to give L-ascorbate, (2R)-2-[(1S)-1,2-dihydroxyethyl]-4-hydroxy-5-oxo-2,5-dihydrofuran-3-olate, which is required as a cofactor in the oxidation of prolyl residues to hydroxyprolyl, and other reactions.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

12 records
Show feature table
Start End DB Term Name
1 203 SMART SM00934 OMPdecase_2
1 203 InterPro IPR001754 Orotidine 5'-phosphate decarboxylase domain
6 211 SUPERFAMILY SSF51366 Ribulose-phoshate binding barrel
6 211 InterPro IPR011060 Ribulose-phosphate binding barrel
2 202 Pfam PF00215 Orotidine 5'-phosphate decarboxylase / HUMPS family
2 202 InterPro IPR001754 Orotidine 5'-phosphate decarboxylase domain
1 209 FunFam G3DSA:3.20.20.70:FF:000022 3-keto-L-gulonate-6-phosphate decarboxylase UlaD
1 203 CDD cd04726 KGPDC_HPS
1 203 InterPro IPR041710 HPS/KGPDC domain
1 209 PANTHER PTHR35039 3-KETO-L-GULONATE-6-PHOSPHATE DECARBOXYLASE SGBH-RELATED
1 210 Gene3D G3DSA:3.20.20.70 Aldolase class I
1 210 InterPro IPR013785 Aldolase-type TIM barrel

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.889
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.279
Likely same site as FPocket 9 0.1 Å 6 shared residues 86% of smaller site
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.222
Show in viewer
Surrounding area
Pocket 4 P2Rank #4
0.005
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #5
0.656
Show in viewer
Surrounding area
Pocket 2 FPocket #9
0.301
Likely same site as P2Rank 2 0.1 Å 6 shared residues 86% of smaller site
Show in viewer
Surrounding area
Pocket 3 FPocket #6
0.207
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GQN9
AlphaFold DB full sequence Viewing
ColabFold VK055_2874
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

58 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 8 records from similar proteins
Structural ligands 8 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
5RP PDB via homolog 230.1 Da · LogP -2.62 · TPSA 144.5 Open detail RCSB PDB
BMP PDB via homolog Detail RCSB PDB
HMS PDB via homolog Detail RCSB PDB
LG6 PDB via homolog Detail RCSB PDB
LX1 PDB via homolog Detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
5RP RCSB PDB P39304 230.1 Da LogP -2.62 TPSA 144.5 ✓ Ro5 ✓ Clean C([C@H]([C@H](C(=O)CO)O)O)OP(=O)(O)O
BMP RCSB PDB O29333 340.2 Da LogP -3.03 TPSA 191.5 1 viol. ✓ Clean C1=C(N(C(=O)NC1=O)[C@H]2[C@@H]([C@@H]([C@H](O2)…
HMS RCSB PDB P39304 230.1 Da LogP -2.62 TPSA 144.5 ✓ Ro5 ✓ Clean C([C@@H]([C@@H](C(=O)CO)O)O)OP(=O)(O)O
LG6 RCSB PDB P39304 276.1 Da LogP -3.38 TPSA 185.0 1 viol. ✓ Clean C([C@@H]([C@H]([C@@H]([C@@H](C(=O)O)O)O)O)O)OP(…
LX1 RCSB PDB P39304 216.1 Da LogP -1.80 TPSA 127.5 ✓ Ro5 ✓ Clean C[C@H]([C@@H]([C@H](COP(=O)(O)O)O)O)O
LXP RCSB PDB P39304 232.1 Da LogP -2.83 TPSA 147.7 1 viol. ✓ Clean C([C@H]([C@@H]([C@H](COP(=O)(O)O)O)O)O)O
MLI RCSB PDB Q8ZMP9 102.0 Da LogP -3.12 TPSA 80.3 ✓ Ro5 ✓ Clean C(C(=O)[O-])C(=O)[O-]
TX4 RCSB PDB P39304 233.1 Da LogP -2.89 TPSA 159.7 1 viol. ✓ Clean C([C@@H]([C@H](C(NO)O)O)O)OP(=O)(O)O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.