Promising target candidate with multiple supporting evidence streams.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Evidence coverage
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- No hit
- Gut microbiome similarity
- 1.5% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- N
- DEG identity (%)
- 0.0 Higher values support similarity to known essential genes.
Structure confidence
- ColabFold pLDDT
- 97.2 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
PDB experimental structureP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MRNLGGGEILHACPQESLDKPLPCIVFYHGFTSSKLVYSYFAVALAEAGFRVIMPDAPEHGARYQGDEAGRMQRFWPILQQNFREFPALREAIIAEGWLEGERLAVAGASMGGMTALGIMTHHPELNSVACLMGSGYFRSLSQTLFPSPDFDVDSLNEWDVSHQLASLARRPLLLWHGDADDVVPPEETFRLEQALRQADLAARLTCVWQKGVRHRITPEALATTVAFFQQHL
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- Unknown
Enzyme Commission (EC)
1Gene Ontology (GO)
3- GO:0008236 Catalysis of the hydrolysis of peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
- GO:0006508 The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
- GO:0047372 Catalysis of the reaction: a monoacylglycerol + H2O = a fatty acid + glycerol + H+.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 2 | 233 | Gene3D | G3DSA:3.40.50.1820 | alpha/beta hydrolase |
| 2 | 233 | InterPro | IPR029058 | Alpha/Beta hydrolase fold |
| 46 | 233 | Pfam | PF00326 | Prolyl oligopeptidase family |
| 46 | 233 | InterPro | IPR001375 | Peptidase S9, prolyl oligopeptidase, catalytic domain |
| 10 | 202 | PANTHER | PTHR22946 | UNCHARACTERIZED |
| 14 | 233 | SUPERFAMILY | SSF53474 | alpha/beta-Hydrolases |
| 14 | 233 | InterPro | IPR029058 | Alpha/Beta hydrolase fold |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
All structural evidence
Structural evidence
1 + 1Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural ligand evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| 1QW RCSB PDB | P82597 | 274.4 Da LogP 2.80 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCC(=O)OC[C@@H](CO)O
|
|
| 1QX RCSB PDB | P82597 | 333.4 Da LogP 5.81 TPSA 95.3 | 1 viol. | Alert |
CCCCCCCCCCCCOP(=O)(CCCN=[N+]=[N-])O
|
|
| 1QY RCSB PDB | P82597 | 361.5 Da LogP 6.59 TPSA 95.3 | 1 viol. | Alert |
CCCCCCCCCCCCCCO[P@@](=O)(CCCN=[N+]=[N-])O
|
|
| 1R1 RCSB PDB | P82597 | 389.5 Da LogP 7.37 TPSA 95.3 | 1 viol. | Alert |
CCCCCCCCCCCCCCCCOP(=O)(CCCN=[N+]=[N-])O
|
|
| PMS RCSB PDB | P82597 | 172.2 Da LogP 1.07 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
c1ccc(cc1)CS(=O)(=O)O
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC100297583 ZINC | 1.000 | 232.3 Da LogP 1.63 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCCC(=O)OC[C@@H](O)CO
|
| ZINC100503477 ZINC | 1.000 | 260.4 Da LogP 2.41 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCC(=O)OC[C@H](O)CO
|
| ZINC100503478 ZINC | 1.000 | 260.4 Da LogP 2.41 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCC(=O)OC[C@@H](O)CO
|
| ZINC2516268 ZINC | 1.000 | 218.3 Da LogP 1.24 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCC(=O)OC[C@H](O)CO
|
| ZINC2516269 ZINC | 1.000 | 246.3 Da LogP 2.02 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCC(=O)OC[C@H](O)CO
|
| ZINC2568190 ZINC | 1.000 | 232.3 Da LogP 1.63 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCCC(=O)OC[C@H](O)CO
|
| ZINC32840883 ZINC | 1.000 | 302.5 Da LogP 3.58 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCC(=O)OC[C@@H](O)CO
|
| ZINC32840884 ZINC | 1.000 | 302.5 Da LogP 3.58 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCC(=O)OC[C@H](O)CO
|
| ZINC32840889 ZINC | 1.000 | 316.5 Da LogP 3.97 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCCC(=O)OC[C@@H](O)CO
|
| ZINC32840890 ZINC | 1.000 | 316.5 Da LogP 3.97 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCCC(=O)OC[C@H](O)CO
|
| ZINC32840891 ZINC | 1.000 | 330.5 Da LogP 4.36 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCCCC(=O)OC[C@@H](O)CO
|
| ZINC32840892 ZINC | 1.000 | 330.5 Da LogP 4.36 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCCCC(=O)OC[C@H](O)CO
|
| ZINC38153421 ZINC | 1.000 | 246.3 Da LogP 2.02 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCC(=O)OC[C@@H](O)CO
|
| ZINC72400435 ZINC | 1.000 | 344.5 Da LogP 4.75 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCCCCC(=O)OC[C@@H](O)CO
|
| ZINC77313111 ZINC | 1.000 | 344.5 Da LogP 4.75 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCCCCC(=O)OC[C@H](O)CO
|
| ZINC8437476 ZINC | 1.000 | 274.4 Da LogP 2.80 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCC(=O)OC[C@H](O)CO
|
| ZINC8437478 ZINC | 1.000 | 274.4 Da LogP 2.80 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCC(=O)OC[C@@H](O)CO
|
| ZINC8674155 ZINC | 1.000 | 218.3 Da LogP 1.24 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCC(=O)OC[C@@H](O)CO
|
| ZINC95669489 ZINC | 1.000 | 288.4 Da LogP 3.19 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCC(=O)OC[C@H](O)CO
|
| ZINC95669491 ZINC | 1.000 | 288.4 Da LogP 3.19 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCC(=O)OC[C@@H](O)CO
|
| ZINC4411080 ZINC | 0.875 | 374.6 Da LogP 4.12 TPSA 87.0 | ✓ Ro5 | ✓ Clean |
CCCCCC[C@H](O)CCCCCCCCCCC(=O)OC[C@H](O)CO
|
| ZINC4411082 ZINC | 0.875 | 374.6 Da LogP 4.12 TPSA 87.0 | ✓ Ro5 | ✓ Clean |
CCCCCC[C@@H](O)CCCCCCCCCCC(=O)OC[C@H](O)CO
|
| ZINC4411083 ZINC | 0.875 | 374.6 Da LogP 4.12 TPSA 87.0 | ✓ Ro5 | ✓ Clean |
CCCCCC[C@H](O)CCCCCCCCCCC(=O)OC[C@@H](O)CO
|
| ZINC4411084 ZINC | 0.875 | 374.6 Da LogP 4.12 TPSA 87.0 | ✓ Ro5 | ✓ Clean |
CCCCCC[C@@H](O)CCCCCCCCCCC(=O)OC[C@@H](O)CO
|
| ZINC95866539 ZINC | 0.875 | 432.6 Da LogP 4.52 TPSA 96.2 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCCCCCC(=O)OC[C@H](O)COC[C@H](O)CO
|
| ZINC95866540 ZINC | 0.875 | 432.6 Da LogP 4.52 TPSA 96.2 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCCCCCC(=O)OC[C@@H](O)COC[C@H](O)CO
|
| ZINC95866542 ZINC | 0.875 | 432.6 Da LogP 4.52 TPSA 96.2 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCCCCCC(=O)OC[C@H](O)COC[C@@H](O)CO
|
| ZINC95866544 ZINC | 0.875 | 432.6 Da LogP 4.52 TPSA 96.2 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCCCCCC(=O)OC[C@@H](O)COC[C@@H](O)CO
|
| ZINC85603366 ZINC | 0.828 | 344.5 Da LogP 4.15 TPSA 72.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCC(=O)OCC(O)COC(=O)CCCCCCC
|
| ZINC1501016272 ZINC | 0.824 | 328.5 Da LogP 4.14 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCCC/C=C\CCCCCCC(=O)OC[C@H](O)CO
|
| ZINC1501016273 ZINC | 0.824 | 328.5 Da LogP 4.14 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCCC/C=C\CCCCCCC(=O)OC[C@@H](O)CO
|
| ZINC1501016315 ZINC | 0.824 | 314.5 Da LogP 3.75 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCC/C=C\CCCCCCC(=O)OC[C@@H](O)CO
|
| ZINC1501016316 ZINC | 0.824 | 314.5 Da LogP 3.75 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCC/C=C\CCCCCCC(=O)OC[C@H](O)CO
|
| ZINC2038077522 ZINC | 0.824 | 356.5 Da LogP 4.92 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCCC=CCCCCCCCC(=O)OC[C@@H](O)CO
|
| ZINC2038077523 ZINC | 0.824 | 356.5 Da LogP 4.92 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCCC=CCCCCCCCC(=O)OC[C@H](O)CO
|
| ZINC221534416 ZINC | 0.824 | 328.5 Da LogP 4.14 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCC/C=C\CCCCCC(=O)OC[C@@H](O)CO
|
| ZINC32840893 ZINC | 0.824 | 328.5 Da LogP 4.14 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCC/C=C\CCCCCCCC(=O)OC[C@@H](O)CO
|
| ZINC32840894 ZINC | 0.824 | 328.5 Da LogP 4.14 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCC/C=C/CCCCCCCC(=O)OC[C@@H](O)CO
|
| ZINC32840895 ZINC | 0.824 | 328.5 Da LogP 4.14 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCC/C=C\CCCCCCCC(=O)OC[C@H](O)CO
|
| ZINC32840896 ZINC | 0.824 | 328.5 Da LogP 4.14 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCC/C=C/CCCCCCCC(=O)OC[C@H](O)CO
|
| ZINC32840901 ZINC | 0.824 | 356.5 Da LogP 4.92 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCC/C=C\CCCCCCCC(=O)OC[C@@H](O)CO
|
| ZINC32840902 ZINC | 0.824 | 356.5 Da LogP 4.92 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCC/C=C/CCCCCCCC(=O)OC[C@@H](O)CO
|
| ZINC32840903 ZINC | 0.824 | 356.5 Da LogP 4.92 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCC/C=C\CCCCCCCC(=O)OC[C@H](O)CO
|
| ZINC32840904 ZINC | 0.824 | 356.5 Da LogP 4.92 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCC/C=C/CCCCCCCC(=O)OC[C@H](O)CO
|
| ZINC725433050 ZINC | 0.824 | 342.5 Da LogP 4.53 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCC/C=C\CCCCCCC(=O)OC[C@@H](O)CO
|
| ZINC725433052 ZINC | 0.824 | 342.5 Da LogP 4.53 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCC/C=C\CCCCCCC(=O)OC[C@H](O)CO
|
| ZINC98208566 ZINC | 0.824 | 328.5 Da LogP 4.14 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCC/C=C\CCCCCC(=O)OC[C@H](O)CO
|
| ZINC85808798 ZINC | 0.818 | 290.4 Da LogP 1.77 TPSA 87.0 | ✓ Ro5 | ✓ Clean |
CCCCCCC[C@H](O)CCCC(=O)OC[C@H](O)CO
|
| ZINC85808802 ZINC | 0.818 | 290.4 Da LogP 1.77 TPSA 87.0 | ✓ Ro5 | ✓ Clean |
CCCCCCC[C@@H](O)CCCC(=O)OC[C@H](O)CO
|
| ZINC85808811 ZINC | 0.818 | 290.4 Da LogP 1.77 TPSA 87.0 | ✓ Ro5 | ✓ Clean |
CCCCCCC[C@H](O)CCCC(=O)OC[C@@H](O)CO
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.