Protein target profile

VK055_2895

tRNA dimethylallyltransferase

Genome: KpATCC43816 Gene: miaA AIK81484.1 3D evidence: AlphaFold DB model + ColabFold model Metabolism 1 reaction UniProt A0A0H3GI16
Length 301
Pocket druggability 0.939
Metabolic reactions 1
Chokepoint Yes
Direct ligand evidence 0 55 total records
Functional annotation 1 EC 4 GO
Target summary

Strong target candidate with converging metabolic, structural and chemical evidence.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
40.196 Lower values reduce human off-target concern.
Human E-value
2.44e-17
Gut microbiome similarity
5.0% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
92.282 Higher values support similarity to known essential genes.
DEG E-value
0.0 Smaller values mean stronger essential-gene similarity.

Localization

Localization
Cytoplasmic

Structure confidence

ColabFold pLDDT
95.62 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

The selected pocket score is the FPocket value used for ranking after applying the curated structure priority. It estimates small-molecule pocket quality; it is not experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

FPocket 0.939
Structure A0A0H3GI16
Pocket Pocket 2
P2Rank 0.915
Structure A0A0H3GI16
Pocket Pocket 1
ColabFold model
FPocket 0.924 · Pocket 2
P2Rank 0.878 · Pocket 1
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 235 / 4744 genomes with a hit
Prevalence 5.0%

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

Explore metabolic network

Attractive metabolic target: catalyzes a producing chokepoint reaction in Zeatin biosynthesis, no isoenzyme backup detected, more central than 89.0% of genes in this genome.

Relative network centrality 89.0% more central than 89.0% of genes in this genome
Chokepoint Chokepoint gene
Catalyzed reaction

1 reaction mapped to this gene in the metabolic model. Open the full network to see each one, with substrates/products and the reaction-reaction map.

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MGPTASGKTALAIALRKVLPVELISVDSALIYRGMDIGTAKPDAAELSAAPHRLLDILDPAEAYSAADFRRDALAAMADIVAAGRIPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWNALHQQLQEIDPVAAARIHPNDPQRLSRALEVFFISGKTLTELTQTSGDALPYQVHQFAIAPASRELLHQRIEQRFHQMLASGFEAEVRALFARGDLHTDMPSIRCVGYRQMWSYLNGEIPYDEMVYRGVCATRQLAKRQVTWLRGWEGVHWLDSEQPEQALNKVLQVVGASQN

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 4 GO

Enzyme Commission (EC)

1

Gene Ontology (GO)

4
  • GO:0008033 The process in which a pre-tRNA molecule is converted to a mature tRNA, ready for addition of an aminoacyl group.
  • GO:0005524 Binding to ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
  • GO:0052381 Catalysis of the reaction: adenosine(37) in tRNA + dimethylallyl diphosphate = N(6)-dimethylallyladenosine(37) in tRNA + diphosphate.
  • GO:0006400 The covalent alteration of one or more nucleotides within a tRNA molecule to produce a tRNA molecule with a sequence that differs from that coded genetically.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

13 records
Show feature table
Start End DB Term Name
31 273 Pfam PF01715 IPP transferase
1 142 SUPERFAMILY SSF52540 P-loop containing nucleoside triphosphate hydrolases
1 142 InterPro IPR027417 P-loop containing nucleoside triphosphate hydrolase
1 299 Gene3D G3DSA:3.40.50.300 -
1 299 InterPro IPR027417 P-loop containing nucleoside triphosphate hydrolase
105 175 Gene3D G3DSA:1.10.20.140 -
105 175 FunFam G3DSA:1.10.20.140:FF:000001 tRNA dimethylallyltransferase
1 294 PANTHER PTHR11088 TRNA DIMETHYLALLYLTRANSFERASE
1 294 InterPro IPR039657 Dimethylallyltransferase
1 294 Hamap MF_00185 tRNA dimethylallyltransferase [miaA].
1 294 InterPro IPR018022 IPP transferase
1 285 NCBIfam TIGR00174 tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA
1 285 InterPro IPR018022 IPP transferase

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · FPocket

Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Site 1 FPocket #2
0.939
Likely same site as P2Rank 2 1.1 Å 25 shared residues 100% of smaller site
Unusual size
Show in viewer
Surrounding area
Site 2 FPocket #3
0.226
Show in viewer
Surrounding area

Binding pockets · P2Rank

Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Site 1 P2Rank #1
0.915
Show in viewer
Surrounding area
Site 2 P2Rank #2
0.797
Likely same site as FPocket 2 1.1 Å 25 shared residues 100% of smaller site
Show in viewer
Surrounding area
Residue sets
UniProt: Binding site:2-9
UniProt: Binding site:4-9
UniProt: Site:115-115 Interaction with substrate tRNA
UniProt: Site:93-93 Interaction with substrate tRNA
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GI16
AlphaFold DB full sequence Viewing
ColabFold VK055_2895
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

55 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 5 records from similar proteins
Structural ligands 5 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
6IA PDB via homolog 417.4 Da · LogP 0.01 · TPSA 172.1 Open detail RCSB PDB
DMA PDB via homolog Detail RCSB PDB
DPO PDB via homolog Detail RCSB PDB
DST PDB via homolog Detail RCSB PDB
PPV PDB via homolog Detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
6IA RCSB PDB P07884 417.4 Da LogP 0.01 TPSA 172.1 ✓ Ro5 ✓ Clean CC(C)CCNc1c2c(ncn1)n(cn2)[C@H]3[C@@H]([C@@H]([C…
DMA RCSB PDB P07884 246.1 Da LogP 1.18 TPSA 113.3 ✓ Ro5 ✓ Clean CC(=CCO[P@@](=O)(O)OP(=O)(O)O)C
DPO RCSB PDB Q9HUL9 173.9 Da LogP -3.34 TPSA 135.6 ✓ Ro5 ✓ Clean [O-]P(=O)([O-])OP(=O)([O-])[O-]
DST RCSB PDB P16384 262.2 Da LogP 1.90 TPSA 104.1 ✓ Ro5 ✓ Clean CC(=CCS[P@@](=O)(O)OP(=O)(O)O)C
PPV RCSB PDB P07884 178.0 Da LogP -0.81 TPSA 124.3 ✓ Ro5 ✓ Clean OP(=O)(O)OP(=O)(O)O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.