Protein target profile

VK055_3255

yiiP

Genome: KpATCC43816 Gene: AIK81816.1 fieF 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GLF2
Length 300
Pocket druggability 0.985
Direct ligand evidence 0 1 total records
Functional annotation 0 EC 13 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
23.529 Lower values reduce human off-target concern.
Human E-value
2.86e-09
Gut microbiome similarity
2.3% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
33.333 Higher values support similarity to known essential genes.

Localization

Localization
CytoplasmicMembrane

Structure confidence

ColabFold pLDDT
90.73 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

The selected pocket score is the FPocket value used for ranking after applying the curated structure priority. It estimates small-molecule pocket quality; it is not experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

FPocket 0.985
Structure A0A0H3GLF2
Pocket Pocket 16
P2Rank 0.7
Structure A0A0H3GLF2
Pocket Pocket 1
ColabFold model
FPocket 0.941 · Pocket 2
P2Rank 0.63 · Pocket 1
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 111 / 4744 genomes with a hit
Prevalence 2.3%

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Sequence

Primary amino-acid sequence viewer.

MNQSYGRLVSRAAIAATAMASALLLIKIFAWWYTGSVSILAALVDSLVDIAASLTNLLVVRYSLQPADEEHTFGHGKAESLAALAQSMFISGSALFLFLTGIQHLVRPEPLQAAGVGVVVTLIALVSTLALVTFQRWVVRKTQSQAVRADMLHYQSDVMMNGAILVALGLSWYGWHRADALFALGIGIYILYSALRMGYEAVQSLLDRALPDEERQDIITIVTAWPGIRGAHDLRTRQSGPTRFIQIHLEMEDNLPLVQAHVIADQVEQAILRRFPGSDVIIHQDPSSVVPAAQQGFFER

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

13 GO

Gene Ontology (GO)

13
  • GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
  • GO:0006812 The directed movement of a monoatomic cation, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore. Monatomic cations (also called simple cations) are positively charged ions consisting of exactly one atom.
  • GO:0008324 Enables the transfer of cation from one side of a membrane to the other.
  • GO:0006826 The directed movement of iron (Fe) ions into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
  • GO:0006829 The directed movement of zinc (Zn II) ions into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
  • GO:0055085 The process in which a solute is transported across a lipid bilayer, from one side of a membrane to the other.
  • GO:0046873 Enables the transfer of metal ions from one side of a membrane to the other.
  • GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
  • GO:0015086 Enables the transfer of cadmium (Cd) ions from one side of a membrane to the other.
  • GO:0015093 Enables the transfer of ferrous iron (Fe(II) or Fe2+) ions from one side of a membrane to the other.
  • GO:0046872 Binding to a metal ion.
  • GO:0015341 Enables the transfer of a zinc ion or zinc ions from the inside of the cell to the outside of the cell across a membrane according to the reaction H+(out) + Zn2+(in) = H+(in) + Zn2+(out). The activity is driven by proton motive force.
  • GO:0006882 A homeostatic process involved in the maintenance of a steady state level of zinc ions within a cell.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

38 records
Show feature table
Start End DB Term Name
112 134 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
180 199 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
80 102 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
200 300 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
9 205 FunFam G3DSA:1.20.1510.10:FF:000001 Ferrous-iron efflux pump FieF
210 286 Pfam PF16916 Dimerisation domain of Zinc Transporter
210 286 InterPro IPR027470 Cation efflux protein, cytoplasmic domain
103 113 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
207 290 Gene3D G3DSA:3.30.70.1350 Cation efflux protein, cytoplasmic domain
207 290 InterPro IPR036837 Cation efflux protein, cytoplasmic domain superfamily
14 206 Pfam PF01545 Cation efflux family
14 206 InterPro IPR002524 Cation efflux protein
158 175 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
61 80 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
114 138 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
81 102 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
34 38 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
8 206 Gene3D G3DSA:1.20.1510.10 Cation efflux protein transmembrane domain
8 206 InterPro IPR027469 Cation efflux transmembrane domain superfamily
1 299 Hamap MF_01425 Cation-efflux pump FieF [fieF].
1 299 InterPro IPR023783 Cation efflux pump FieF
181 199 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
176 180 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
12 34 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
14 287 PANTHER PTHR43840 MITOCHONDRIAL METAL TRANSPORTER 1-RELATED
139 157 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
12 33 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
8 207 SUPERFAMILY SSF161111 Cation efflux protein transmembrane domain-like
8 207 InterPro IPR027469 Cation efflux transmembrane domain superfamily
158 175 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
39 60 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
38 60 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
1 11 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
10 287 NCBIfam TIGR01297 cation diffusion facilitator family transporter
10 287 InterPro IPR002524 Cation efflux protein
207 291 FunFam G3DSA:3.30.70.1350:FF:000002 Ferrous-iron efflux pump FieF
209 287 SUPERFAMILY SSF160240 Cation efflux protein cytoplasmic domain-like
209 287 InterPro IPR036837 Cation efflux protein, cytoplasmic domain superfamily

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · FPocket

Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Site 1 FPocket #16
0.985
Unusual size
Show in viewer
Surrounding area

Binding pockets · P2Rank

Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Site 1 P2Rank #1
0.7
Show in viewer
Surrounding area
Site 2 P2Rank #2
0.517
Show in viewer
Surrounding area
Site 3 P2Rank #3
0.17
Show in viewer
Surrounding area
Site 4 P2Rank #4
0.07
Show in viewer
Surrounding area
Site 5 P2Rank #5
0.041
Show in viewer
Surrounding area
Residue sets
UniProt: Binding site:153-153
UniProt: Binding site:157-157
UniProt: Binding site:45-45
UniProt: Binding site:49-49
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GLF2
AlphaFold DB full sequence Viewing
ColabFold VK055_3255
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

1 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 1 records from similar proteins
Structural ligands 1 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 0 similarity-based ZINC candidates
Best available ligand signal
CO2 PDB via homolog 44.0 Da · LogP -0.58 · TPSA 34.1 Open detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
CO2 RCSB PDB V6F235 44.0 Da LogP -0.58 TPSA 34.1 ✓ Ro5 ✓ Clean C(=O)=O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.