Promising target candidate with multiple supporting evidence streams.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- Hit
- Human identity (%)
- 23.529 Lower values reduce human off-target concern.
- Human E-value
- 2.86e-09
- Gut microbiome similarity
- 2.3% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- N
- DEG identity (%)
- 33.333 Higher values support similarity to known essential genes.
Localization
- Localization
- CytoplasmicMembrane
Structure confidence
- ColabFold pLDDT
- 90.73 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelThe selected pocket score is the FPocket value used for ranking after applying the curated structure priority. It estimates small-molecule pocket quality; it is not experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.
Sequence
Sequence
Primary amino-acid sequence viewer.
MNQSYGRLVSRAAIAATAMASALLLIKIFAWWYTGSVSILAALVDSLVDIAASLTNLLVVRYSLQPADEEHTFGHGKAESLAALAQSMFISGSALFLFLTGIQHLVRPEPLQAAGVGVVVTLIALVSTLALVTFQRWVVRKTQSQAVRADMLHYQSDVMMNGAILVALGLSWYGWHRADALFALGIGIYILYSALRMGYEAVQSLLDRALPDEERQDIITIVTAWPGIRGAHDLRTRQSGPTRFIQIHLEMEDNLPLVQAHVIADQVEQAILRRFPGSDVIIHQDPSSVVPAAQQGFFER
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Gene Ontology (GO)
13- GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
- GO:0006812 The directed movement of a monoatomic cation, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore. Monatomic cations (also called simple cations) are positively charged ions consisting of exactly one atom.
- GO:0008324 Enables the transfer of cation from one side of a membrane to the other.
- GO:0006826 The directed movement of iron (Fe) ions into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
- GO:0006829 The directed movement of zinc (Zn II) ions into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
- GO:0055085 The process in which a solute is transported across a lipid bilayer, from one side of a membrane to the other.
- GO:0046873 Enables the transfer of metal ions from one side of a membrane to the other.
- GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
- GO:0015086 Enables the transfer of cadmium (Cd) ions from one side of a membrane to the other.
- GO:0015093 Enables the transfer of ferrous iron (Fe(II) or Fe2+) ions from one side of a membrane to the other.
- GO:0046872 Binding to a metal ion.
- GO:0015341 Enables the transfer of a zinc ion or zinc ions from the inside of the cell to the outside of the cell across a membrane according to the reaction H+(out) + Zn2+(in) = H+(in) + Zn2+(out). The activity is driven by proton motive force.
- GO:0006882 A homeostatic process involved in the maintenance of a steady state level of zinc ions within a cell.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 112 | 134 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 180 | 199 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 80 | 102 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 200 | 300 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 9 | 205 | FunFam | G3DSA:1.20.1510.10:FF:000001 | Ferrous-iron efflux pump FieF |
| 210 | 286 | Pfam | PF16916 | Dimerisation domain of Zinc Transporter |
| 210 | 286 | InterPro | IPR027470 | Cation efflux protein, cytoplasmic domain |
| 103 | 113 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 207 | 290 | Gene3D | G3DSA:3.30.70.1350 | Cation efflux protein, cytoplasmic domain |
| 207 | 290 | InterPro | IPR036837 | Cation efflux protein, cytoplasmic domain superfamily |
| 14 | 206 | Pfam | PF01545 | Cation efflux family |
| 14 | 206 | InterPro | IPR002524 | Cation efflux protein |
| 158 | 175 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 61 | 80 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 114 | 138 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 81 | 102 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 34 | 38 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 8 | 206 | Gene3D | G3DSA:1.20.1510.10 | Cation efflux protein transmembrane domain |
| 8 | 206 | InterPro | IPR027469 | Cation efflux transmembrane domain superfamily |
| 1 | 299 | Hamap | MF_01425 | Cation-efflux pump FieF [fieF]. |
| 1 | 299 | InterPro | IPR023783 | Cation efflux pump FieF |
| 181 | 199 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 176 | 180 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 12 | 34 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 14 | 287 | PANTHER | PTHR43840 | MITOCHONDRIAL METAL TRANSPORTER 1-RELATED |
| 139 | 157 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 12 | 33 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 8 | 207 | SUPERFAMILY | SSF161111 | Cation efflux protein transmembrane domain-like |
| 8 | 207 | InterPro | IPR027469 | Cation efflux transmembrane domain superfamily |
| 158 | 175 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 39 | 60 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 38 | 60 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 1 | 11 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 10 | 287 | NCBIfam | TIGR01297 | cation diffusion facilitator family transporter |
| 10 | 287 | InterPro | IPR002524 | Cation efflux protein |
| 207 | 291 | FunFam | G3DSA:3.30.70.1350:FF:000002 | Ferrous-iron efflux pump FieF |
| 209 | 287 | SUPERFAMILY | SSF160240 | Cation efflux protein cytoplasmic domain-like |
| 209 | 287 | InterPro | IPR036837 | Cation efflux protein, cytoplasmic domain superfamily |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · FPocket
Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Residue sets
Binding pockets · FPocket
Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Residue sets
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GLF2
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
VK055_3255
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural ligand evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
No virtual-screening candidates for this protein.
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.