Promising target candidate with multiple supporting evidence streams.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- Hit
- Human identity (%)
- 71.03 Lower values reduce human off-target concern.
- Human E-value
- 0.0
- Gut microbiome similarity
- 69.6% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- Y
- DEG identity (%)
- 98.478 Higher values support similarity to known essential genes.
- DEG E-value
- 0.0 Smaller values mean stronger essential-gene similarity.
Localization
- Localization
- Cytoplasmic
Structure confidence
- ColabFold pLDDT
- 93.31 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelThe selected pocket score is the FPocket value used for ranking after applying the curated structure priority. It estimates small-molecule pocket quality; it is not experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.
Sequence
Chemistry
Sequence
Primary amino-acid sequence viewer.
MATGKIVQVIGAVVDVEFPQDAVPRVYEALEVQNGNEVLVLEVQQQLGGGIVRTIAMGSSDGLRRGLDVKDLEHPIEVPVGKATLGRIMNVLGQPVDMKGDIGEEERWAIHRAAPSYEELSSSQELLETGIKVIDLMCPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGYSVFAGVGERTREGNDFYHEMTDSNVIDKVSLVYGQMNEPPGNRLRVALTGLTMAEKFRDEGRDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSRQIASLGIYPAVDPLDSTSRQLDPLVVGQEHYDTARGVQSILQRYQELKDIIAILGMDELSEEDKLVVARARKIQRFLSQPFFVAEVFTGSPGKYVALKDTIRGFKGIMEGEYDHLPEQAFYMVGSIDEAVEKAKKL
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Enzyme Commission (EC)
1Gene Ontology (GO)
9- GO:0005524 Binding to ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
- GO:0015986 The chemical reactions and pathways resulting in the formation of ATP driven by transport of protons across a membrane to generate an electrochemical gradient (proton-motive force).
- GO:0045261 OBSOLETE. The sector of a hydrogen-transporting ATP synthase complex in which the catalytic activity resides; it comprises the catalytic core and central stalk, and is peripherally associated with a membrane, such as the plasma membrane or the mitochondrial inner membrane, when the entire ATP synthase is assembled.
- GO:0046034 The chemical reactions and pathways involving ATP, adenosine triphosphate, a universally important coenzyme and enzyme regulator.
- GO:0046933 Enables the synthesis of ATP from ADP and phosphate by the transfer of protons from one side of a membrane to the other by a rotational mechanism driven by a gradient according to the reaction: ADP + phosphate + 5 H+(out) => ATP + H2O + 4 H+(in).
- GO:1902600 The directed movement of a proton across a membrane.
- GO:0016887 Catalysis of the reaction: ATP + H2O = ADP + H+ phosphate. ATP hydrolysis is used in some reactions as an energy source, for example to catalyze a reaction or drive transport against a concentration gradient.
- GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
- GO:0045259 A proton-transporting two-sector ATPase complex that catalyzes the phosphorylation of ADP to ATP during oxidative phosphorylation. The complex comprises a membrane sector (F0) that carries out proton transport and a cytoplasmic compartment sector (F1) that catalyzes ATP synthesis by a rotational mechanism; the extramembrane sector (containing 3 a and 3 b subunits) is connected via the d-subunit to the membrane sector by several smaller subunits. Within this complex, the g and e subunits and the 9-12 c subunits rotate by consecutive 120 degree angles and perform parts of ATP synthesis. This movement is driven by the hydrogen ion electrochemical potential gradient.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 76 | 344 | Gene3D | G3DSA:3.40.50.300 | - |
| 76 | 344 | InterPro | IPR027417 | P-loop containing nucleoside triphosphate hydrolase |
| 1 | 460 | Hamap | MF_01347 | ATP synthase subunit beta [atpB]. |
| 1 | 460 | InterPro | IPR005722 | ATP synthase, F1 complex, beta subunit |
| 3 | 460 | NCBIfam | TIGR01039 | F0F1 ATP synthase subunit beta |
| 3 | 460 | InterPro | IPR005722 | ATP synthase, F1 complex, beta subunit |
| 77 | 347 | CDD | cd01133 | F1-ATPase_beta_CD |
| 1 | 75 | SUPERFAMILY | SSF50615 | N-terminal domain of alpha and beta subunits of F1 ATP synthase |
| 1 | 75 | InterPro | IPR036121 | ATPase, F1/V1/A1 complex, alpha/beta subunit, N-terminal domain superfamily |
| 349 | 456 | CDD | cd18110 | ATP-synt_F1_beta_C |
| 77 | 348 | SUPERFAMILY | SSF52540 | P-loop containing nucleoside triphosphate hydrolases |
| 77 | 348 | InterPro | IPR027417 | P-loop containing nucleoside triphosphate hydrolase |
| 76 | 344 | FunFam | G3DSA:3.40.50.300:FF:000004 | ATP synthase subunit beta |
| 2 | 75 | Gene3D | G3DSA:2.40.10.170 | - |
| 2 | 460 | PANTHER | PTHR15184 | ATP SYNTHASE |
| 345 | 460 | FunFam | G3DSA:1.10.1140.10:FF:000001 | ATP synthase subunit beta |
| 450 | 460 | Coils | Coil | Coil |
| 345 | 460 | Gene3D | G3DSA:1.10.1140.10 | - |
| 345 | 460 | InterPro | IPR024034 | ATPase, F1/V1 complex, beta/alpha subunit, C-terminal |
| 2 | 76 | CDD | cd18115 | ATP-synt_F1_beta_N |
| 345 | 459 | SUPERFAMILY | SSF47917 | C-terminal domain of alpha and beta subunits of F1 ATP synthase |
| 6 | 72 | Pfam | PF02874 | ATP synthase alpha/beta family, beta-barrel domain |
| 6 | 72 | InterPro | IPR004100 | ATPase, F1/V1/A1 complex, alpha/beta subunit, N-terminal domain |
| 333 | 342 | ProSitePatterns | PS00152 | ATP synthase alpha and beta subunits signature. |
| 333 | 342 | InterPro | IPR020003 | ATPase, alpha/beta subunit, nucleotide-binding domain, active site |
| 1 | 75 | FunFam | G3DSA:2.40.10.170:FF:000003 | ATP synthase subunit beta |
| 142 | 327 | SMART | SM00382 | AAA_5 |
| 142 | 327 | InterPro | IPR003593 | AAA+ ATPase domain |
| 130 | 342 | Pfam | PF00006 | ATP synthase alpha/beta family, nucleotide-binding domain |
| 130 | 342 | InterPro | IPR000194 | ATPase, F1/V1/A1 complex, alpha/beta subunit, nucleotide-binding domain |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · FPocket
Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Residue sets
Binding pockets · FPocket
Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Residue sets
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GVB4
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
VK055_3336
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural and bioactivity evidence are both available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| AF3 RCSB PDB | P00829 | 84.0 Da LogP 0.88 TPSA 0.0 | ✓ Ro5 | ✓ Clean |
F[Al](F)F
|
|
| ALF RCSB PDB | P00829 | 103.0 Da LogP 1.30 TPSA 0.0 | ✓ Ro5 | ✓ Clean |
F[Al-](F)(F)F
|
|
| ANP RCSB PDB | P0ABB4 | 506.2 Da LogP -2.06 TPSA 281.9 | 3 viol. | ✓ Clean |
c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
|
|
| AUR RCSB PDB | P00829 | 460.5 Da LogP 3.10 TPSA 104.4 | ✓ Ro5 | ✓ Clean |
CC[C@@H]1[C@]2([C@H]([C@@](O1)([C@H]([C@@H](O2)…
|
|
| AZI RCSB PDB | P00829 | 42.0 Da LogP 0.87 TPSA 58.7 | ✓ Ro5 | Alert |
[N-]=[N+]=[N-]
|
|
| BEF RCSB PDB | P00829 | 66.0 Da LogP 0.88 TPSA 0.0 | ✓ Ro5 | ✓ Clean |
[Be-](F)(F)F
|
|
| DCW RCSB PDB | P00829 | 224.3 Da LogP 2.95 TPSA 41.1 | ✓ Ro5 | ✓ Clean |
C1CCC(CC1)NC(=O)NC2CCCCC2
|
|
| QUE RCSB PDB | P00829 | 302.2 Da LogP 1.99 TPSA 131.4 | ✓ Ro5 | Alert |
c1cc(c(cc1C2=C(C(=O)c3c(cc(cc3O2)O)O)O)O)O
|
|
| STL RCSB PDB | P00829 | 228.2 Da LogP 2.97 TPSA 60.7 | ✓ Ro5 | ✓ Clean |
c1cc(ccc1\C=C\c2cc(cc(c2)O)O)O
|
|
| TS6 RCSB PDB | P00829 | 114.1 Da LogP 0.01 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
OP(=O)(O)S
|
|
| TTX RCSB PDB | P00825 | 414.5 Da LogP 0.99 TPSA 98.8 | ✓ Ro5 | ✓ Clean |
C[C@H]1C(=O)N[C@H](C(=O)N(/C(=C\c2ccccc2)/C(=O)…
|
|
| VO4 RCSB PDB | P10719 | 114.9 Da LogP -3.69 TPSA 86.2 | ✓ Ro5 | ✓ Clean |
[O-][V](=O)([O-])[O-]
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
| Ligand | UniProt (homolog) | pchembl | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| CHEMBL2063416 ChEMBL | P06576 | — | 716.8 Da LogP 1.65 TPSA 238.1 | 3 viol. | Alert |
O=C(CCCC[C@@H]1SC[C@@H]2NC(=O)N[C@@H]21)NCCOCCO…
|
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC100230999 ZINC | 1.000 | 414.5 Da LogP 0.99 TPSA 98.8 | ✓ Ro5 | ✓ Clean |
CC(C)C[C@@H]1NC(=O)[C@H](C)N(C)C(=O)CNC(=O)/C(=…
|
| ZINC12353732 ZINC | 1.000 | 228.2 Da LogP 2.97 TPSA 60.7 | ✓ Ro5 | ✓ Clean |
Oc1ccc(/C=C\c2cc(O)cc(O)c2)cc1
|
| ZINC1531101 ZINC | 1.000 | 414.5 Da LogP 0.99 TPSA 98.8 | ✓ Ro5 | ✓ Clean |
CC(C)C[C@H]1NC(=O)[C@@H](C)N(C)C(=O)CNC(=O)C(=C…
|
| ZINC157375 ZINC | 1.000 | 224.3 Da LogP 2.95 TPSA 41.1 | ✓ Ro5 | ✓ Clean |
O=C(NC1CCCCC1)NC1CCCCC1
|
| ZINC1857524289 ZINC | 1.000 | 228.2 Da LogP 2.97 TPSA 60.7 | ✓ Ro5 | ✓ Clean |
Oc1ccc(C=Cc2cc(O)cc(O)c2)cc1
|
| ZINC2356469567 ZINC | 1.000 | 414.5 Da LogP 0.99 TPSA 98.8 | ✓ Ro5 | ✓ Clean |
CC(C)C[C@@H]1NC(=O)[C@@H](C)N(C)C(=O)CNC(=O)C(=…
|
| ZINC33955459 ZINC | 1.000 | 414.5 Da LogP 0.99 TPSA 98.8 | ✓ Ro5 | ✓ Clean |
CC(C)C[C@@H]1NC(=O)[C@H](C)N(C)C(=O)CNC(=O)/C(=…
|
| ZINC370205 ZINC | 1.000 | 252.4 Da LogP 3.73 TPSA 41.1 | ✓ Ro5 | ✓ Clean |
O=C(NC1CCCCCCC1)NC1CCCCC1
|
| ZINC376044 ZINC | 1.000 | 238.4 Da LogP 3.34 TPSA 41.1 | ✓ Ro5 | ✓ Clean |
O=C(NC1CCCCCC1)NC1CCCCC1
|
| ZINC3875061 ZINC | 1.000 | 414.5 Da LogP 0.99 TPSA 98.8 | ✓ Ro5 | ✓ Clean |
CC(C)C[C@H]1NC(=O)[C@H](C)N(C)C(=O)CNC(=O)C(=Cc…
|
| ZINC4097591 ZINC | 1.000 | 414.5 Da LogP 0.99 TPSA 98.8 | ✓ Ro5 | ✓ Clean |
CC(C)C[C@@H]1NC(=O)[C@H](C)N(C)C(=O)CNC(=O)C(=C…
|
| ZINC44123745 ZINC | 1.000 | 252.4 Da LogP 3.73 TPSA 41.1 | ✓ Ro5 | ✓ Clean |
O=C(NC1CCCCCC1)NC1CCCCCC1
|
| ZINC6787 ZINC | 1.000 | 228.2 Da LogP 2.97 TPSA 60.7 | ✓ Ro5 | ✓ Clean |
Oc1ccc(/C=C/c2cc(O)cc(O)c2)cc1
|
| ZINC48844720 ZINC | 0.944 | 210.3 Da LogP 2.56 TPSA 41.1 | ✓ Ro5 | ✓ Clean |
O=C(NC1CCCCCCC1)NC1CC1
|
| ZINC12360002 ZINC | 0.810 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CO[P@@](=O)(O)OP(=O…
|
| ZINC12360703 ZINC | 0.810 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CO[P@@](=O)(O)OP(=O…
|
| ZINC12503599 ZINC | 0.810 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CO[P@@](=O)(O)OP(=O…
|
| ZINC16546165 ZINC | 0.810 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@H](CO[P@](=O)(O)OP(=O)(…
|
| ZINC31977053 ZINC | 0.810 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](CO[P@](=O)(O)OP(=O)…
|
| ZINC4806433 ZINC | 0.810 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CO[P@@](=O)(O)OP(=O…
|
| ZINC53683898 ZINC | 0.810 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](CO[P@@](=O)(O)OP(=…
|
| ZINC8586019 ZINC | 0.810 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](CO[P@](=O)(O)OP(=O)…
|
| ZINC8586020 ZINC | 0.810 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](CO[P@@](=O)(O)OP(=…
|
| ZINC8586021 ZINC | 0.810 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](CO[P@@](=O)(O)OP(=O…
|
| ZINC8586022 ZINC | 0.810 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](CO[P@@](=O)(O)OP(=…
|
| ZINC12343510 ZINC | 0.810 | 364.5 Da LogP 3.56 TPSA 82.3 | ✓ Ro5 | ✓ Clean |
O=C(NC1CCCCC1)N[C@H]1CCCC[C@H]1NC(=O)NC1CCCCC1
|
| ZINC637766 ZINC | 0.810 | 364.5 Da LogP 3.56 TPSA 82.3 | ✓ Ro5 | ✓ Clean |
O=C(NC1CCCCC1)N[C@@H]1CCCC[C@H]1NC(=O)NC1CCCCC1
|
| ZINC637768 ZINC | 0.810 | 364.5 Da LogP 3.56 TPSA 82.3 | ✓ Ro5 | ✓ Clean |
O=C(NC1CCCCC1)N[C@H]1CCCC[C@@H]1NC(=O)NC1CCCCC1
|
| ZINC35115081 ZINC | 0.773 | 240.3 Da LogP 1.92 TPSA 61.4 | ✓ Ro5 | ✓ Clean |
O=C(NC1CCCCC1)NC1CCC(O)CC1
|
| ZINC3874317 ZINC | 0.757 | 318.2 Da LogP 1.69 TPSA 151.6 | 1 viol. | Alert |
O=c1c(O)c(-c2cc(O)c(O)c(O)c2)oc2cc(O)cc(O)c12
|
| ZINC13518964 ZINC | 0.741 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](COP(=O)(O)O)[C@H](…
|
| ZINC1532515 ZINC | 0.741 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](COP(=O)(O)O)[C@H](O…
|
| ZINC1571045 ZINC | 0.741 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](COP(=O)(O)O)[C@@H]…
|
| ZINC1842158 ZINC | 0.741 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](COP(=O)(O)O)[C@H](O…
|
| ZINC2046931 ZINC | 0.741 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](COP(=O)(O)O)[C@H](…
|
| ZINC2126310 ZINC | 0.741 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](COP(=O)(O)O)[C@@H](…
|
| ZINC3201891 ZINC | 0.741 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](COP(=O)(O)O)[C@@H]…
|
| ZINC3201893 ZINC | 0.741 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](COP(=O)(O)O)[C@@H](…
|
| ZINC3830180 ZINC | 0.741 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](COP(=O)(O)O)[C@@H](…
|
| ZINC3860156 ZINC | 0.741 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](COP(=O)(O)O)[C@@H](…
|
| ZINC3977897 ZINC | 0.741 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@H](COP(=O)(O)O)[C@@H](O…
|
| ZINC4806442 ZINC | 0.741 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](COP(=O)(O)O)[C@H](O…
|
| ZINC8613167 ZINC | 0.741 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](COP(=O)(O)O)[C@H](O…
|
| ZINC4910418 ZINC | 0.739 | 225.3 Da LogP 1.37 TPSA 53.2 | ✓ Ro5 | ✓ Clean |
O=C(NC1CCCCC1)NC1CCNCC1
|
| ZINC13319959 ZINC | 0.737 | 212.2 Da LogP 3.27 TPSA 40.5 | ✓ Ro5 | ✓ Clean |
Oc1ccc(/C=C\c2ccc(O)cc2)cc1
|
| ZINC1510311 ZINC | 0.737 | 212.2 Da LogP 3.27 TPSA 40.5 | ✓ Ro5 | ✓ Clean |
Oc1ccc(/C=C/c2ccc(O)cc2)cc1
|
| ZINC1875408805 ZINC | 0.737 | 212.2 Da LogP 3.27 TPSA 40.5 | ✓ Ro5 | ✓ Clean |
Oc1ccc(C=Cc2ccc(O)cc2)cc1
|
| ZINC4096224 ZINC | 0.729 | 346.2 Da LogP -1.90 TPSA 191.9 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CO[P@](N)(=O)O)[C@@…
|
| ZINC141163786 ZINC | 0.726 | 427.3 Da LogP -2.04 TPSA 229.4 | 1 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CO[P@](=O)(O)OS(=O)…
|
| ZINC4228246 ZINC | 0.726 | 427.3 Da LogP -2.04 TPSA 229.4 | 1 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CO[P@@](=O)(O)OS(=O…
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.