Protein target profile

VK055_3458

glpF - glycerol MIP channel

Genome: KpATCC43816 Gene: glpF2 AIK82014.1 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3H4L2
Length 283
Pocket druggability 0.973
Direct ligand evidence 0 63 total records
Functional annotation 0 EC 5 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
44.211 Lower values reduce human off-target concern.
Human E-value
1.75e-12
Gut microbiome similarity
3.1% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
34.426 Higher values support similarity to known essential genes.

Localization

Localization
CytoplasmicMembrane

Structure confidence

ColabFold pLDDT
92.69 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

The selected pocket score is the FPocket value used for ranking after applying the curated structure priority. It estimates small-molecule pocket quality; it is not experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

FPocket 0.973
Structure A0A0H3H4L2
Pocket Pocket 1
P2Rank 0.639
Structure A0A0H3H4L2
Pocket Pocket 1
ColabFold model
FPocket 0.94 · Pocket 1
P2Rank 0.682 · Pocket 1
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 147 / 4744 genomes with a hit
Prevalence 3.1%

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Sequence

Primary amino-acid sequence viewer.

MSQTSTLKGQCIAEFLGTGLLIFFGVGCVAALKVAGASFGQWEISIIWGLGVAMAIYLTAGVSGAHLNPAVTIALWLFACFEGRKVVPFIISQFAGAFCAAALVYGLYYNLFLDYETTHHMIRGSVESLDLAGIFSTYPNPHINFVQAFAVEMVITAILMGVILALTDDGNGIPRGPLAPLLIGLLIAVIGASMGPLTGFAMNPARDIGPKAFAWLAGWGDVAFTGGKDIPYFLVPLCAPVVGAALGAFSYRKLIGRHLPCDTCVEEEQQSPSSSTAQHKASL

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

5 GO

Gene Ontology (GO)

5
  • GO:0015267 Enables the energy-independent facilitated diffusion of a solute through a transmembrane aqueous pore or channel. Stereospecificity is not exhibited but this transport may be specific for a particular molecular species or class of molecules.
  • GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
  • GO:0055085 The process in which a solute is transported across a lipid bilayer, from one side of a membrane to the other.
  • GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
  • GO:0015254 Enables the energy-independent facilitated diffusion of glycerol through a transmembrane aqueous pore or channel.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

45 records
Show feature table
Start End DB Term Name
250 283 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
10 254 CDD cd00333 MIP
10 254 InterPro IPR000425 Major intrinsic protein
9 272 PANTHER PTHR43829 AQUAPORIN OR AQUAGLYCEROPORIN RELATED
198 229 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
230 249 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
178 200 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
86 108 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
1 259 Gene3D G3DSA:1.20.1080.10 Glycerol uptake facilitator protein.
1 259 InterPro IPR023271 Aquaporin-like
2 251 Pfam PF00230 Major intrinsic protein
2 251 InterPro IPR000425 Major intrinsic protein
145 166 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
178 197 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
13 251 NCBIfam TIGR00861 MIP family channel protein
13 251 InterPro IPR000425 Major intrinsic protein
143 165 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
80 85 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
85 104 PRINTS PR00783 Major intrinsic protein family signature
85 104 InterPro IPR000425 Major intrinsic protein
151 169 PRINTS PR00783 Major intrinsic protein family signature
151 169 InterPro IPR000425 Major intrinsic protein
48 72 PRINTS PR00783 Major intrinsic protein family signature
48 72 InterPro IPR000425 Major intrinsic protein
9 28 PRINTS PR00783 Major intrinsic protein family signature
9 28 InterPro IPR000425 Major intrinsic protein
184 206 PRINTS PR00783 Major intrinsic protein family signature
184 206 InterPro IPR000425 Major intrinsic protein
234 254 PRINTS PR00783 Major intrinsic protein family signature
234 254 InterPro IPR000425 Major intrinsic protein
12 34 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
44 66 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
1 259 FunFam G3DSA:1.20.1080.10:FF:000004 Glycerol facilitator
9 257 SUPERFAMILY SSF81338 Aquaporin-like
9 257 InterPro IPR023271 Aquaporin-like
109 144 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
167 177 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
66 74 ProSitePatterns PS00221 MIP family signature.
66 74 InterPro IPR022357 Major intrinsic protein, conserved site
86 108 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
12 34 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
46 79 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
230 249 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
35 45 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
1 11 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · FPocket

Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Site 1 FPocket #1
0.973
Likely same site as P2Rank 1 1.5 Å 26 shared residues 100% of smaller site
Unusual size
Show in viewer
Surrounding area
Site 2 FPocket #7
0.503
Likely same site as P2Rank 4 2.7 Å 9 shared residues 100% of smaller site
Show in viewer
Surrounding area
Site 3 FPocket #15
0.342
Show in viewer
Surrounding area
Site 4 FPocket #6
0.249
Show in viewer
Surrounding area

Binding pockets · P2Rank

Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Site 1 P2Rank #1
0.639
Likely same site as FPocket 1 1.5 Å 26 shared residues 100% of smaller site
Show in viewer
Surrounding area
Site 2 P2Rank #2
0.475
Show in viewer
Surrounding area
Site 3 P2Rank #3
0.031
Show in viewer
Surrounding area
Site 4 P2Rank #4
0.016
Likely same site as FPocket 7 2.7 Å 9 shared residues 100% of smaller site
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3H4L2
AlphaFold DB full sequence Viewing
ColabFold VK055_3458
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

63 records
Chemistry signal

Structural and bioactivity evidence are both available for this target.

Direct evidence 0 same-protein records
Transferred evidence 13 records from similar proteins
Structural ligands 2 0 loaded crystals
Measured bioactivity 11 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
3PE PDB via homolog 748.1 Da · LogP 12.06 · TPSA 134.4 Open detail RCSB PDB
PS6 PDB via homolog Detail RCSB PDB
AZM ChEMBL via homolog Detail ChEMBL
CHEMBL121 ChEMBL via homolog Detail ChEMBL
CHEMBL128 ChEMBL via homolog Detail ChEMBL

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
3PE RCSB PDB Q6J8I9 748.1 Da LogP 12.06 TPSA 134.4 2 viol. ✓ Clean CCCCCCCCCCCCCCCCCC(=O)OC[C@H](COP(=O)(O)OCCN)OC…
PS6 RCSB PDB P55064 567.7 Da LogP 5.27 TPSA 171.7 2 viol. ✓ Clean CCCCCCCCCCCCCC(=O)OC[C@@H](CO[P@@](=O)(O)OC[C@H…

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.