KpATCC43816 Protein target profile

peptidyl-prolyl cis-trans isomerase in protein folding

Accession: VK055_3742

Gene: AIK82297.1 3D evidence: AlphaFold DB model + ColabFold model Metabolism 2 reactions UniProt A0A0H3GU42
Length 276
Pocket druggability (P2Rank · AlphaFold DB model) 0.26
Metabolic reactions 2
Chokepoint No
Direct ligand evidence 0 62 total records
Functional annotation 1 EC 2 GO
Target summary

Target candidate with partial support; inspect missing evidence before prioritizing.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
52.5 Lower values reduce human off-target concern.
Human E-value
1.42e-17
Gut microbiome similarity
2.4% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
42.105 Higher values support similarity to known essential genes.

Structure confidence

ColabFold pLDDT
83.97 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.26
Structure A0A0H3GU42
Pocket Pocket 1
Druggability (FPocket) 0.163
Structure A0A0H3GU42
Pocket Pocket 1
ColabFold model
P2Rank 0.218 · Pocket 1
FPocket 0.164 · Pocket 7
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 112 / 4744 genomes with a hit
Prevalence 2.4%

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

Explore metabolic network
Relative network centrality 0.0% more central than 0.0% of genes in this genome
Chokepoint Not a chokepoint
Pathways

No specific KEGG pathway assigned - this reaction either has no KEGG mapping, or only matches a generic overview map with no route-level information.

Catalyzed reactions

2 reactions mapped to this gene in the metabolic model. Open the full network to see each one, with substrates/products and the reaction-reaction map.

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MKSLFKVTLLATTMAVALNAPLTFAADTATKAAPAAESKSAFKNDDQKSAYALGASLGRYMENSLKEQEKLGIKLDKAQLIAGVQDAFADKSKLSDQEIEQTLQAFETRVKTAAQQKMEKDATENEAKGKAFRDSFAKEKGVKTSKTGLLYKVEKEGAGDAPKDSDTVVVNYKGTLIDGKEFDNSYTRGEPLSFRLDGVIPGWTEGLKNIKKGGKIKLVIPPDLAYGKTGVPGIPANSTLVFDVELLDIKPAPKADAQPEAAGDAKAADAKADAKK

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 2 GO

Subcellular localization

Localization
Periplasmic

Enzyme Commission (EC)

1

Gene Ontology (GO)

2
  • GO:0006457 The process of assisting in the covalent and noncovalent assembly of single chain polypeptides or multisubunit complexes into the correct tertiary structure.
  • GO:0003755 Catalysis of the reaction: peptidyl-proline (omega=180) = peptidyl-proline (omega=0).

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

21 records
Show feature table
Start End DB Term Name
19 25 Phobius SIGNAL_PEPTIDE_C_REGION C-terminal region of a signal peptide.
1 25 Phobius SIGNAL_PEPTIDE Signal peptide region
161 247 Pfam PF00254 FKBP-type peptidyl-prolyl cis-trans isomerase
161 247 InterPro IPR001179 FKBP-type peptidyl-prolyl cis-trans isomerase domain
1 25 SignalP_GRAM_NEGATIVE SignalP-noTM SignalP-noTM
26 276 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
1 25 SignalP_GRAM_POSITIVE SignalP-TM SignalP-TM
27 143 Gene3D G3DSA:1.10.287.460 -
27 143 InterPro IPR036944 Peptidyl-prolyl cis-trans isomerase, FKBP-type, N-terminal domain superfamily
47 260 PANTHER PTHR43811 FKBP-TYPE PEPTIDYL-PROLYL CIS-TRANS ISOMERASE FKPA
144 252 FunFam G3DSA:3.10.50.40:FF:000004 Peptidyl-prolyl cis-trans isomerase
165 250 ProSiteProfiles PS50059 FKBP-type peptidyl-prolyl cis-trans isomerase domain profile.
165 250 InterPro IPR001179 FKBP-type peptidyl-prolyl cis-trans isomerase domain
253 276 MobiDBLite mobidb-lite consensus disorder prediction
144 258 Gene3D G3DSA:3.10.50.40 -
144 258 InterPro IPR046357 Peptidyl-prolyl cis-trans isomerase domain superfamily
1 6 Phobius SIGNAL_PEPTIDE_N_REGION N-terminal region of a signal peptide.
7 18 Phobius SIGNAL_PEPTIDE_H_REGION Hydrophobic region of a signal peptide.
42 250 SUPERFAMILY SSF54534 FKBP-like
47 153 Pfam PF01346 Domain amino terminal to FKBP-type peptidyl-prolyl isomerase
47 153 InterPro IPR000774 Peptidyl-prolyl cis-trans isomerase, FKBP-type, N-terminal

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.26
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GU42
AlphaFold DB full sequence Viewing
ColabFold VK055_3742
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

62 records
Chemistry signal

Structural and bioactivity evidence are both available for this target.

Direct evidence 0 same-protein records
Transferred evidence 12 records from similar proteins
Structural ligands 10 0 loaded crystals
Measured bioactivity 2 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
4GI PDB via homolog 433.5 Da · LogP 2.71 · TPSA 119.7 Open detail RCSB PDB
6UO PDB via homolog Detail RCSB PDB
854 PDB via homolog Detail RCSB PDB
861 PDB via homolog Detail RCSB PDB
FK5 PDB via homolog Detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
4GI RCSB PDB Q3JK38 433.5 Da LogP 2.71 TPSA 119.7 ✓ Ro5 ✓ Clean c1cc(cc(c1)S(=O)(=O)N2CCCC[C@H]2C(=O)OCCCc3cccn…
6UO RCSB PDB Q3JK38 432.5 Da LogP 2.17 TPSA 102.9 ✓ Ro5 ✓ Clean c1ccc(cc1)CS(=O)(=O)N2CCCC[C@H]2C(=O)OCCOC(=O)c…
854 RCSB PDB Q3JK38 311.4 Da LogP 1.93 TPSA 63.7 ✓ Ro5 ✓ Clean CCOC(=O)[C@@H]1CCCCN1S(=O)(=O)Cc2ccccc2
861 RCSB PDB Q3JK38 491.6 Da LogP 3.57 TPSA 91.4 ✓ Ro5 ✓ Clean COc1cc(cc(c1OC)OC)CCCOC(=O)[C@@H]2CCCCN2S(=O)(=…
FK5 RCSB PDB P45523 804.0 Da LogP 4.64 TPSA 178.4 2 viol. ✓ Clean C[C@@H]1C[C@@H]([C@@H]2[C@H](C[C@H]([C@@](O2)(C…
L2S RCSB PDB Q3JK38 249.4 Da LogP 3.10 TPSA 20.3 ✓ Ro5 ✓ Clean Cc1ccc(cc1)SCC(=O)N2CCCCC2
LL7 RCSB PDB Q3JK38 519.6 Da LogP 2.54 TPSA 123.3 1 viol. ✓ Clean COc1cc(cc(c1OC)OC)NC(=O)CCNC(=O)[C@@H]2CCCCN2S(…
LLD RCSB PDB Q3JK38 431.5 Da LogP 1.74 TPSA 105.7 ✓ Ro5 ✓ Clean c1ccc(cc1)CS(=O)(=O)N2CCCC[C@H]2C(=O)OCCNC(=O)c…
RAP RCSB PDB Q5ZXE0 914.2 Da LogP 6.18 TPSA 195.4 3 viol. ✓ Clean C[C@@H]1CC[C@H]2C[C@@H](C(=CC=C\C=C\[C@H](C[C@H…
TLA RCSB PDB Q88B84 150.1 Da LogP -2.12 TPSA 115.1 ✓ Ro5 ✓ Clean [C@@H]([C@H](C(=O)O)O)(C(=O)O)O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.