Protein target profile

VK055_3808

ribosomal protein L11 methyltransferase

Genome: KpATCC43816 Gene: AIK82358.1 prmA 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GWC1
Length 293
Pocket druggability 0.985
Direct ligand evidence 0 57 total records
Functional annotation 1 EC 6 GO
Target summary

Target candidate with partial support; inspect missing evidence before prioritizing.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
3.6% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
69.863 Higher values support similarity to known essential genes.
DEG E-value
5.56e-153 Smaller values mean stronger essential-gene similarity.

Localization

Localization
Cytoplasmic

Structure confidence

ColabFold pLDDT
87.09 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

The selected pocket score is the FPocket value used for ranking after applying the curated structure priority. It estimates small-molecule pocket quality; it is not experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

FPocket 0.985
Structure A0A0H3GWC1
Pocket Pocket 4
P2Rank 0.4
Structure A0A0H3GWC1
Pocket Pocket 1
ColabFold model
FPocket 0.98 · Pocket 14
P2Rank 0.371 · Pocket 1
Core conservation Accessory gene
Roary core
CoreCruncher accessory
Gut microbiome 172 / 4744 genomes with a hit
Prevalence 3.6%

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Sequence

Primary amino-acid sequence viewer.

MPWIQLKLNTTGANAEDLSDALMEAGSVSITFQDTHDTPVFEPLPGETRLWGDTDVIGLFDAETDMKAVVAQLEQHPLLGAGFAHKIEQLEDKDWEREWMDNFHPMRFGERLWICPSWRDVPDENAVNVMLDPGLAFGTGTHPTTSLCLQWLDGLDLNGKTVIDFGCGSGILAIAALKLGAAKAIGIDIDPQAIQASRDNAQRNGVSERLELYLPQDQPESMKADVVVANILAGPLRELAPLISVLPVSGGLLGLSGILASQAESVCEAYADLFALDPVVEKEEWCRITGRKN

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 6 GO

Enzyme Commission (EC)

1

Gene Ontology (GO)

6
  • GO:0008276 Catalysis of the transfer of a methyl group (CH3-) to a protein.
  • GO:0006479 The addition of a methyl group to a protein amino acid. A methyl group is derived from methane by the removal of a hydrogen atom.
  • GO:0005829 The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
  • GO:0005840 An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.
  • GO:0016279 Catalysis of the transfer of a methyl group from S-adenosyl-L-methionine to the epsilon-amino group of a lysine residue in a protein substrate.
  • GO:0032259 The process in which a methyl group is covalently attached to a molecule.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

14 records
Show feature table
Start End DB Term Name
101 293 Gene3D G3DSA:3.40.50.150 Vaccinia Virus protein VP39
101 293 InterPro IPR029063 S-adenosyl-L-methionine-dependent methyltransferase superfamily
3 286 NCBIfam TIGR00406 50S ribosomal protein L11 methyltransferase
3 286 InterPro IPR004498 Ribosomal protein L11 methyltransferase
1 292 Hamap MF_00735 Ribosomal protein L11 methyltransferase [prmA].
1 292 InterPro IPR004498 Ribosomal protein L11 methyltransferase
1 293 PIRSF PIRSF000401 RPL11_MTase
1 293 InterPro IPR004498 Ribosomal protein L11 methyltransferase
101 293 FunFam G3DSA:3.40.50.150:FF:000021 Ribosomal protein L11 methyltransferase
44 291 SUPERFAMILY SSF53335 S-adenosyl-L-methionine-dependent methyltransferases
44 291 InterPro IPR029063 S-adenosyl-L-methionine-dependent methyltransferase superfamily
1 292 PANTHER PTHR43648 ELECTRON TRANSFER FLAVOPROTEIN BETA SUBUNIT LYSINE METHYLTRANSFERASE
161 230 CDD cd02440 AdoMet_MTases
3 292 Pfam PF06325 Ribosomal protein L11 methyltransferase (PrmA)

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · FPocket

Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Site 1 FPocket #4
0.985
Likely same site as P2Rank 1 2.2 Å 15 shared residues 88% of smaller site
Unusual size
Show in viewer
Surrounding area

Binding pockets · P2Rank

Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Site 1 P2Rank #1
0.4
Likely same site as FPocket 4 2.2 Å 15 shared residues 88% of smaller site
Show in viewer
Surrounding area
Site 2 P2Rank #2
0.013
Show in viewer
Surrounding area
Residue sets
UniProt: Binding site:145-145
UniProt: Binding site:166-166
UniProt: Binding site:188-188
UniProt: Binding site:230-230
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GWC1
AlphaFold DB full sequence Viewing
ColabFold VK055_3808
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

57 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 7 records from similar proteins
Structural ligands 7 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
2MM PDB via homolog 177.3 Da · LogP 0.75 · TPSA 40.5 Open detail RCSB PDB
AZ8 PDB via homolog Detail RCSB PDB
AZ9 PDB via homolog Detail RCSB PDB
MEQ PDB via homolog Detail RCSB PDB
PG0 PDB via homolog Detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
2MM RCSB PDB Q84BQ9 177.3 Da LogP 0.75 TPSA 40.5 ✓ Ro5 ✓ Clean CN(C)[C@@H](CCSC)C(=O)O
AZ8 RCSB PDB Q9LBJ0 165.1 Da LogP -1.60 TPSA 104.4 ✓ Ro5 ✓ Clean c1nc2c(nn1)NC(=O)NC2=O
AZ9 RCSB PDB Q9LBJ0 179.1 Da LogP -1.59 TPSA 93.5 ✓ Ro5 ✓ Clean CN1C(=O)c2c(nncn2)NC1=O
MEQ RCSB PDB Q9WYV8 160.2 Da LogP -1.08 TPSA 92.4 ✓ Ro5 ✓ Clean CNC(=O)CC[C@@H](C(=O)O)N
PG0 RCSB PDB Q9NRN9 120.1 Da LogP -0.36 TPSA 38.7 ✓ Ro5 ✓ Clean COCCOCCO
SFG RCSB PDB Q84BQ9 381.4 Da LogP -2.06 TPSA 208.7 2 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
TOF RCSB PDB Q9LBJ0 193.2 Da LogP -1.63 TPSA 82.7 ✓ Ro5 ✓ Clean CN1C2=NC(=O)N(C(=O)C2=NC=N1)C

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.