Protein target profile
VK055_3880
octaprenyl-diphosphate synthase
Strong target candidate with converging metabolic, structural and chemical evidence.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Evidence coverage
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- Hit
- Human identity (%)
- 30.96 Lower values reduce human off-target concern.
- Human E-value
- 8.67e-42
- Gut microbiome similarity
- 3.9% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- Y
- DEG identity (%)
- 92.547 Higher values support similarity to known essential genes.
- DEG E-value
- 0.0 Smaller values mean stronger essential-gene similarity.
Localization
- Localization
- Cytoplasmic
Structure confidence
- ColabFold pLDDT
- 92.83 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelThe selected pocket score is the FPocket value used for ranking after applying the curated structure priority. It estimates small-molecule pocket quality; it is not experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.
Sequence
Chemistry
Pathways
Sequence
Primary amino-acid sequence viewer.
MNLEKINELTAQDMAGVNATILEQLNSDVQLINQLGYYIVSGGGKRIRPMIAVLAARAVGYQGSAHVTIAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQMMTQLGSLKILEVMSEAVNVIAEGEVLQLMNVNDPDITEENYMRVIYSKTARLFEAASQCAGLLADCTAEEERALQDYGRYLGTAFQLIDDLLDYSSDGERLGKNVGDDLNEGKPTLPLLHAMHHGTPDQSAMIRGAIEQGNGRHLLDAVLETMATCGSLEWTQKRAEEEADKAIAALQILPDTPWREALIGLAHIAVQRDH
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Gene Ontology (GO)
1- GO:0008299 The chemical reactions and pathways resulting in the formation of an isoprenoid compound, isoprene (2-methylbuta-1,3-diene) or compounds containing or derived from linked isoprene (3-methyl-2-butenylene) residues.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 6 | 322 | SUPERFAMILY | SSF48576 | Terpenoid synthases |
| 6 | 322 | InterPro | IPR008949 | Isoprenoid synthase domain superfamily |
| 81 | 95 | ProSitePatterns | PS00723 | Polyprenyl synthases signature 1. |
| 81 | 95 | InterPro | IPR033749 | Polyprenyl synthetase, conserved site |
| 39 | 321 | SFLD | SFLDS00005 | Isoprenoid Synthase Type I |
| 27 | 321 | CDD | cd00685 | Trans_IPPS_HT |
| 27 | 321 | InterPro | IPR000092 | Polyprenyl synthetase |
| 203 | 215 | ProSitePatterns | PS00444 | Polyprenyl synthases signature 2. |
| 203 | 215 | InterPro | IPR033749 | Polyprenyl synthetase, conserved site |
| 1 | 323 | Gene3D | G3DSA:1.10.600.10 | Farnesyl Diphosphate Synthase |
| 1 | 323 | InterPro | IPR008949 | Isoprenoid synthase domain superfamily |
| 4 | 321 | PANTHER | PTHR12001 | GERANYLGERANYL PYROPHOSPHATE SYNTHASE |
| 1 | 323 | FunFam | G3DSA:1.10.600.10:FF:000002 | Octaprenyl diphosphate synthase |
| 30 | 263 | Pfam | PF00348 | Polyprenyl synthetase |
| 30 | 263 | InterPro | IPR000092 | Polyprenyl synthetase |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · FPocket
Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3H3J7
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
VK055_3880
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural and bioactivity evidence are both available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| 2DE RCSB PDB | O66129 | 368.3 Da LogP 4.24 TPSA 113.3 | ✓ Ro5 | ✓ Clean |
CC(=CCC/C(=C/CC/C=C/CO[P@](=O)(O)OP(=O)(O)O)/C)C
|
|
| B29 RCSB PDB | P0AD57 | 448.3 Da LogP 3.80 TPSA 148.4 | ✓ Ro5 | ✓ Clean |
c1ccc2c(c1)c3cccc(c3o2)c4cccc(c4)CC(O)(P(=O)(O)…
|
|
| DMA RCSB PDB | Q8NT37 | 246.1 Da LogP 1.18 TPSA 113.3 | ✓ Ro5 | ✓ Clean |
CC(=CCO[P@@](=O)(O)OP(=O)(O)O)C
|
|
| FPP RCSB PDB | Q5HZ00 | 382.3 Da LogP 4.63 TPSA 113.3 | ✓ Ro5 | ✓ Clean |
CC(=CCC/C(=C/CC/C(=C/CO[P@@](=O)(O)OP(=O)(O)O)/…
|
|
| HJX RCSB PDB | P0AD57 | 350.5 Da LogP 6.17 TPSA 66.8 | 1 viol. | ✓ Clean |
CCCCCCCCCCCCCCOc1cccc(c1C(=O)O)O
|
|
| ISY RCSB PDB | Q5HZ00 | 262.2 Da LogP 1.90 TPSA 104.1 | ✓ Ro5 | ✓ Clean |
CC(=C)CCS[P@@](=O)(O)OP(=O)(O)O
|
|
| POP RCSB PDB | Q9A6I1 | 176.0 Da LogP -2.08 TPSA 129.9 | ✓ Ro5 | ✓ Clean |
O[P@@](=O)([O-])O[P@@](=O)(O)[O-]
|
|
| PPV RCSB PDB | Q5HZ00 | 178.0 Da LogP -0.81 TPSA 124.3 | ✓ Ro5 | ✓ Clean |
OP(=O)(O)OP(=O)(O)O
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
| Ligand | UniProt (homolog) | pchembl | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| CHEMBL260601 ChEMBL | Q964Q8 | 6.60 ~251.2 nM | 317.3 Da LogP 1.62 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
CCCCCCCCNCC(P(=O)(O)O)P(=O)(O)O
|
| CHEMBL407221 ChEMBL | Q964Q8 | 6.12 ~758.6 nM | 247.1 Da LogP -0.33 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
CC(C)NCC(P(=O)(O)O)P(=O)(O)O
|
| FCN ChEMBL | P0AD57 | — | 138.1 Da LogP -0.09 TPSA 70.1 | ✓ Ro5 | ✓ Clean |
C[C@H]1[C@H](O1)P(=O)(O)O
|
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC16051958 ZINC | 1.000 | 448.3 Da LogP 3.80 TPSA 148.4 | ✓ Ro5 | ✓ Clean |
O=P(O)(O)C(O)(Cc1cccc(-c2cccc3c2oc2ccccc23)c1)P…
|
| ZINC36176055 ZINC | 1.000 | 303.2 Da LogP 1.23 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
CCCCCCCNCC(P(=O)(O)O)P(=O)(O)O
|
| ZINC8215740 ZINC | 1.000 | 246.1 Da LogP 1.18 TPSA 113.3 | ✓ Ro5 | ✓ Clean |
CC(C)=CCO[P@@](=O)(O)OP(=O)(O)O
|
| ZINC71769106 ZINC | 0.923 | 326.1 Da LogP 1.30 TPSA 159.8 | ✓ Ro5 | ✓ Clean |
CC(C)=CCO[P@@](=O)(O)O[P@@](=O)(O)OP(=O)(O)O
|
| ZINC8215849 ZINC | 0.719 | 314.2 Da LogP 2.91 TPSA 113.3 | ✓ Ro5 | ✓ Clean |
CC(C)=CCC/C(C)=C/CO[P@@](=O)(O)OP(=O)(O)O
|
| ZINC8436838 ZINC | 0.700 | 262.1 Da LogP 0.15 TPSA 133.5 | ✓ Ro5 | ✓ Clean |
C/C(=C\CO[P@@](=O)(O)OP(=O)(O)O)CO
|
| ZINC12494625 ZINC | 0.697 | 382.3 Da LogP 4.63 TPSA 113.3 | ✓ Ro5 | ✓ Clean |
CC(C)=CCC/C(C)=C/CC/C(C)=C/CO[P@@](=O)(O)OP(=O)…
|
| ZINC2356589248 ZINC | 0.697 | 382.3 Da LogP 4.63 TPSA 113.3 | ✓ Ro5 | ✓ Clean |
CC(C)=CCCC(C)=CCCC(C)=CCO[P@](=O)(O)OP(=O)(O)O
|
| ZINC34661063 ZINC | 0.676 | 394.2 Da LogP 3.02 TPSA 159.8 | ✓ Ro5 | ✓ Clean |
CC(C)=CCC/C(C)=C/CO[P@@](=O)(O)O[P@@](=O)(O)OP(…
|
| ZINC8218174 ZINC | 0.657 | 462.3 Da LogP 4.75 TPSA 159.8 | ✓ Ro5 | ✓ Clean |
CC(C)=CCC/C(C)=C/CC/C(C)=C/CO[P@@](=O)(O)O[P@@]…
|
| ZINC86477899 ZINC | 0.641 | 212.2 Da LogP 2.70 TPSA 46.5 | ✓ Ro5 | ✓ Clean |
CCCCOc1cccc(F)c1C(=O)O
|
| ZINC11958423 ZINC | 0.632 | 222.3 Da LogP 3.34 TPSA 46.5 | ✓ Ro5 | ✓ Clean |
CCCCCCOc1ccccc1C(=O)O
|
| ZINC59030357 ZINC | 0.632 | 250.3 Da LogP 4.12 TPSA 46.5 | ✓ Ro5 | ✓ Clean |
CCCCCCCCOc1ccccc1C(=O)O
|
| ZINC7261547 ZINC | 0.605 | 208.3 Da LogP 2.95 TPSA 46.5 | ✓ Ro5 | ✓ Clean |
CCCCCOc1ccccc1C(=O)O
|
| ZINC16051959 ZINC | 0.574 | 434.3 Da LogP 3.56 TPSA 135.3 | ✓ Ro5 | ✓ Clean |
O=P(O)(O)C(O)(Cc1cccc(-c2cccc(-c3ccccc3)c2)c1)P…
|
| ZINC16051960 ZINC | 0.574 | 434.3 Da LogP 3.56 TPSA 135.3 | ✓ Ro5 | ✓ Clean |
O=P(O)(O)C(O)(Cc1cccc(-c2ccc(-c3ccccc3)cc2)c1)P…
|
| ZINC13539354 ZINC | 0.571 | 332.2 Da LogP 3.20 TPSA 113.3 | ✓ Ro5 | ✓ Clean |
CC(C)=CCC/C(C)=C(\F)CO[P@](=O)(O)OP(=O)(O)O
|
| ZINC20502776 ZINC | 0.565 | 393.1 Da LogP -2.06 TPSA 242.1 | 1 viol. | ✓ Clean |
O=P(O)(O)C(CNCC(P(=O)(O)O)P(=O)(O)O)P(=O)(O)O
|
| ZINC39250619 ZINC | 0.564 | 244.2 Da LogP 2.67 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
O=C(O)c1c(O)cccc1OCc1ccccc1
|
| ZINC2530984 ZINC | 0.556 | 210.2 Da LogP 2.18 TPSA 55.8 | ✓ Ro5 | ✓ Clean |
CCOc1cccc(OCC)c1C(=O)O
|
| ZINC58563493 ZINC | 0.553 | 326.4 Da LogP 4.83 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCOc1ccc(/C=C\c2cccc(O)c2C(=O)O)cc1
|
| ZINC20516945 ZINC | 0.550 | 220.3 Da LogP 3.85 TPSA 26.3 | ✓ Ro5 | ✓ Clean |
CCCCCCOc1ccccc1C(C)=O
|
| ZINC59087957 ZINC | 0.550 | 234.3 Da LogP 4.24 TPSA 26.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCOc1ccccc1C(C)=O
|
| ZINC100667816 ZINC | 0.548 | 229.4 Da LogP 3.49 TPSA 32.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCNC[C@H](C)O
|
| ZINC2310427 ZINC | 0.548 | 264.3 Da LogP 2.73 TPSA 61.4 | ✓ Ro5 | ✓ Clean |
CCCCCNCP(=O)(O)CNCCCCC
|
| ZINC2532336 ZINC | 0.548 | 229.4 Da LogP 3.49 TPSA 32.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCNC[C@@H](C)O
|
| ZINC73371939 ZINC | 0.548 | 257.5 Da LogP 4.27 TPSA 32.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCNC[C@@H](C)O
|
| ZINC73371941 ZINC | 0.548 | 257.5 Da LogP 4.27 TPSA 32.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCNC[C@H](C)O
|
| ZINC106400342 ZINC | 0.537 | 250.3 Da LogP 4.12 TPSA 46.5 | ✓ Ro5 | ✓ Clean |
CCCCCCCCOc1cccc(C(=O)O)c1
|
| ZINC1542919 ZINC | 0.537 | 221.3 Da LogP 2.74 TPSA 52.3 | ✓ Ro5 | ✓ Clean |
CCCCCCOc1ccccc1C(N)=O
|
| ZINC2163669 ZINC | 0.537 | 278.4 Da LogP 4.90 TPSA 46.5 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCOc1cccc(C(=O)O)c1
|
| ZINC196693230 ZINC | 0.526 | 236.3 Da LogP 3.47 TPSA 35.5 | ✓ Ro5 | ✓ Clean |
CCCOc1cccc(OCCC)c1C(C)=O
|
| ZINC2029547 ZINC | 0.525 | 206.3 Da LogP 3.46 TPSA 26.3 | ✓ Ro5 | ✓ Clean |
CCCCCOc1ccccc1C(C)=O
|
| ZINC2144825 ZINC | 0.524 | 224.3 Da LogP 2.01 TPSA 55.8 | ✓ Ro5 | ✓ Clean |
CCOCCOc1cccc(O)c1C(C)=O
|
| ZINC2167300 ZINC | 0.524 | 263.4 Da LogP 4.38 TPSA 38.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCCOc1ccccc1NC(C)=O
|
| ZINC3220773 ZINC | 0.524 | 252.3 Da LogP 3.35 TPSA 55.8 | ✓ Ro5 | ✓ Clean |
CCCCCCOc1ccc(C(=O)O)cc1OC
|
| ZINC45329451 ZINC | 0.524 | 264.4 Da LogP 4.21 TPSA 35.5 | ✓ Ro5 | ✓ Clean |
CCCCCCCCOc1ccccc1C(=O)OC
|
| ZINC5792424 ZINC | 0.524 | 236.3 Da LogP 3.43 TPSA 35.5 | ✓ Ro5 | ✓ Clean |
CCCCCCOc1ccccc1C(=O)OC
|
| ZINC1603333 ZINC | 0.516 | 265.3 Da LogP 3.59 TPSA 69.6 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCNP(=O)(O)O
|
| ZINC100311032 ZINC | 0.515 | 259.4 Da LogP 2.85 TPSA 52.5 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCNC[C@H](O)CO
|
| ZINC100311035 ZINC | 0.515 | 259.4 Da LogP 2.85 TPSA 52.5 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCNC[C@@H](O)CO
|
| ZINC16052649 ZINC | 0.515 | 419.4 Da LogP 4.87 TPSA 115.1 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCC[P+](C)(C)CC(P(=O)(O)O)P(=O)(O)O
|
| ZINC2383776457 ZINC | 0.514 | 272.4 Da LogP 2.91 TPSA 75.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCNC[C@H](N)C(=O)O
|
| ZINC11798718 ZINC | 0.512 | 208.3 Da LogP 2.95 TPSA 46.5 | ✓ Ro5 | ✓ Clean |
CCCCCOc1cccc(C(=O)O)c1
|
| ZINC42393684 ZINC | 0.512 | 222.3 Da LogP 3.26 TPSA 46.5 | ✓ Ro5 | ✓ Clean |
CCCCCOc1cc(C(=O)O)ccc1C
|
| ZINC11953215 ZINC | 0.512 | 301.2 Da LogP 4.11 TPSA 46.5 | ✓ Ro5 | ✓ Clean |
CCCCCCOc1ccc(Br)cc1C(=O)O
|
| ZINC1975391927 ZINC | 0.512 | 258.3 Da LogP 3.62 TPSA 46.5 | ✓ Ro5 | ✓ Clean |
CCCCCCOc1ccc(C(=O)O)c(F)c1F
|
| ZINC2049133 ZINC | 0.512 | 286.3 Da LogP 4.40 TPSA 46.5 | ✓ Ro5 | ✓ Clean |
CCCCCCCCOc1ccc(C(=O)O)c(F)c1F
|
| ZINC526059742 ZINC | 0.512 | 256.3 Da LogP 3.22 TPSA 46.5 | ✓ Ro5 | ✓ Clean |
CC(=O)c1c(O)cccc1OCCc1ccccc1
|
| ZINC95739849 ZINC | 0.512 | 226.2 Da LogP 3.09 TPSA 46.5 | ✓ Ro5 | ✓ Clean |
CCCCCOc1cc(F)ccc1C(=O)O
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.