KpATCC43816 Protein target profile

hypothetical protein

Accession: VK055_4080

Gene: AIK82626.1 3D evidence: AlphaFold DB model + ColabFold model Metabolism Not in network UniProt A0A0W8AJT4
Export view
Length 360
Pocket druggability (P2Rank · AlphaFold DB model) 0.205
Direct ligand evidence 0 3 total records
Functional annotation 1 EC 7 GO
Target summary

Target candidate with partial support; inspect missing evidence before prioritizing.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Main supporting evidence

No similar human protein detected The current BLAST sequence screen did not find a significant human match, lowering apparent off-target risk. Core gene across strains Marked as conserved by both pan-genome tools: Roary and CoreCruncher. Structure available AlphaFold DB model + ColabFold model Ligand evidence via structure/bioactivity 2 structural and 0 bioactivity records.

Risks to review

Microbiome similarity 138 of 4744 screened genomes (2.9%) have a significant similarity hit. This target also has a predicted binding pocket (P2Rank 0.20) — check the ligand evidence before deprioritizing on off-target risk alone. Weak predicted binding pocket FPocket selected-pocket score 0.30. Weak second pocket-predictor signal P2Rank predicted binding-site probability 0.20.

Evidence coverage

Core evidence streams are available for this target.
Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
2.9% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
34.783 Higher values support similarity to known essential genes.

Structure confidence

ColabFold pLDDT
90.06 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.205
Structure A0A0W8AJT4
Pocket Pocket 1
Druggability (FPocket) 0.297
Structure A0A0W8AJT4
Pocket Pocket 4
ColabFold model
P2Rank 0.341 · Pocket 1
FPocket 0.262 · Pocket 3
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 138 / 4744 genomes with a hit
Prevalence 2.9%

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

This protein is not associated with the imported metabolic network for this genome.

Browse the genome's metabolic network

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MKKYLALALIAPLLVSCSSSNKKGAEYNEAWVKDTNGFDILMGQFAHNIENIWGYNEVLLAGPKDYVKYTDQYQTRSHINFDEGTITVETIAGTDPRGRLRQAIVKTLLMGDDPNSIDLYSDVDDIQISKEPFLYGQVVDNTGASIRWEWRAARFADYLLQTRLKSRNNGLRVVYSITINLVPNHLDKRAHKYLGMVRQASRKYGVDESLILAIMQTESSFNPYAVSHADAMGLMQVVQHSAGRDVFRTQGKSGLPSRSYLFDPANNIDTGTAYLAMLNNVYLAGIDNPTSRRYAVITAYNGGAGSVLRVFSSDKVQAANIINSMAPGDVYQTLTTRHPSAESRRYLYKVNTAQKSYRRK

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 7 GO

Subcellular localization

Localization
Unknown

Enzyme Commission (EC)

1

Gene Ontology (GO)

7
  • GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
  • GO:0009279 A lipid bilayer that forms the outermost membrane of the cell envelope; enriched in polysaccharide and protein; the outer leaflet of the membrane contains specific lipopolysaccharide structures.
  • GO:0000270 The chemical reactions and pathways involving peptidoglycans, any of a class of glycoconjugates found only in bacterial cell walls and consisting of long glycan strands of alternating residues of beta-(1,4) linked N-acetylglucosamine and N-acetylmuramic acid, cross-linked by short peptides.
  • GO:0016998 The chemical reactions and pathways resulting in the breakdown of macromolecules that form part of a cell wall.
  • GO:0016798 Catalysis of the hydrolysis of any glycosyl bond.
  • GO:0008933 Catalysis of the cleavage of a peptidoglycan chain into a peptidoglycan chain with N-acetyl-1,6-anhydromuramyl-[peptide] at the reducing end + a peptidoglycan chain with N-acetylglucosamine at the non-reducing end. Includes endolytic transglycosylase activity that fragments the glycan chain internally and exolytic transgylcosylase activity that cleaves a terminal disaccharide from the end of the glycan strand.
  • GO:0071555 A process that results in the assembly, arrangement of constituent parts, or disassembly of the cell wall, the rigid or semi-rigid envelope lying outside the cell membrane of plant, fungal and most prokaryotic cells, maintaining their shape and protecting them from osmotic lysis.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

23 records
Show feature table
Start End DB Term Name
5 359 PANTHER PTHR37423 SOLUBLE LYTIC MUREIN TRANSGLYCOSYLASE-RELATED
31 192 Pfam PF11873 Membrane-bound lytic murein transglycosylase C, N-terminal domain
31 192 InterPro IPR024570 Murein transglycosylase-C, N-terminal
1 359 Hamap MF_01616 Membrane-bound lytic murein transglycosylase C [mltC].
1 359 InterPro IPR023664 Murein transglycosylase-C
1 17 ProSiteProfiles PS51257 Prokaryotic membrane lipoprotein lipid attachment site profile.
177 360 FunFam G3DSA:1.10.530.10:FF:000002 Membrane-bound lytic murein transglycosylase C
214 242 ProSitePatterns PS00922 Prokaryotic transglycosylases signature.
214 242 InterPro IPR000189 Prokaryotic transglycosylase, active site
1 20 SignalP_EUK SignalP-noTM SignalP-noTM
1 4 Phobius SIGNAL_PEPTIDE_N_REGION N-terminal region of a signal peptide.
1 19 Phobius SIGNAL_PEPTIDE Signal peptide region
1 24 SignalP_GRAM_POSITIVE SignalP-TM SignalP-TM
16 19 Phobius SIGNAL_PEPTIDE_C_REGION C-terminal region of a signal peptide.
197 319 Pfam PF01464 Transglycosylase SLT domain
197 319 InterPro IPR008258 Transglycosylase SLT domain 1
178 360 Gene3D G3DSA:1.10.530.10 -
1 24 SignalP_GRAM_NEGATIVE SignalP-noTM SignalP-noTM
192 358 SUPERFAMILY SSF53955 Lysozyme-like
192 358 InterPro IPR023346 Lysozyme-like domain superfamily
20 360 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
196 355 CDD cd16893 LT_MltC_MltE
5 15 Phobius SIGNAL_PEPTIDE_H_REGION Hydrophobic region of a signal peptide.

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.205
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.04
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.039
Show in viewer
Surrounding area
Pocket 4 P2Rank #4
0.035
Show in viewer
Surrounding area
Pocket 5 P2Rank #5
0.019
Likely same site as FPocket 4 0.5 Å 8 shared residues 89% of smaller site
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #4
0.297
Likely same site as P2Rank 5 0.5 Å 8 shared residues 89% of smaller site
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0W8AJT4
AlphaFold DB — — full sequence — Viewing
ColabFold VK055_4080
ColabFold — — full sequence — Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

3 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 2 records from similar proteins
Structural ligands 2 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 1 similarity-based ZINC candidates
Best available ligand signal
BLG PDB via homolog 552.6 Da · LogP -6.16 · TPSA 271.9 Open detail RCSB PDB
BUL PDB via homolog Detail RCSB PDB
ZINC34074657 ZINC proposed compound · Tanimoto 0.562 Detail ZINC

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
BLG RCSB PDB
1SLY
P0AGC3 552.6 Da LogP -6.16 TPSA 271.9 3 viol. ✓ Clean CC(=O)N[C@@H]1[C@H]([C@@H]([C@H](O[C@H]1O[C@H]2…
BUL RCSB PDB
6FCQ
Q9HZI6 551.5 Da LogP -5.13 TPSA 267.3 3 viol. ✓ Clean CC(=O)N[C@@H]1[C@H]([C@@H]([C@H](O[C@H]1O[C@H]2…

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Sequence

UniProt A0A0W8AJT4