Protein target profile

VK055_4150

cytochrome C biogenesis transmembrane region family protein

Genome: KpATCC43816 Gene: AIK82696.1 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GV62
Length 669
Pocket druggability 0.999
Direct ligand evidence 0 1 total records
Functional annotation 0 EC 4 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
1.4% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
32.121 Higher values support similarity to known essential genes.

Localization

Localization
CytoplasmicMembrane

Structure confidence

ColabFold pLDDT
82.55 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

The selected pocket score is the FPocket value used for ranking after applying the curated structure priority. It estimates small-molecule pocket quality; it is not experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

FPocket 0.999
Structure A0A0H3GV62
Pocket Pocket 73
P2Rank 0.588
Structure A0A0H3GV62
Pocket Pocket 1
ColabFold model
FPocket 0.999 · Pocket 1
P2Rank 0.512 · Pocket 1
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 66 / 4744 genomes with a hit
Prevalence 1.4%

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Sequence

Primary amino-acid sequence viewer.

MYMVFRRLLVCLLWLWLPVSQAADSGWLRAADNQHASVRLRAQTESNGDTRLLLDVALEKGWKTYWRSPGEGGIAPAIAWHTPLEVSWRWPTPQRFDVAGISTQGYHGDVSFPMTLRGKIPPTLSGVLTLSTCSNVCILTDYPFSLDMTTPAGERFNYDFTRAMGTLPLRDGLTSQLTASYVSGKLTVTARRDAGWQQPALFIDSMEDVDFGKPSFTSRGDTLTATVPVTDSWGEAAPDLSGKTLSLVLADSGQAQESQIAVAAGSAAPGLALGWVLLMALAGGLILNVMPCVLPVLAMKLGSLVQTEGRERGAVRRQFLASVCGIVVSFLALALMMTALRLGNQALGWGIQFQNPWFIGAMALVMVLFSASLLGLFEIRLSSSASTFLATRGGNGLMGHFWQGAFATLLATPCTAPFLGTAVSVALVAPLPLLWGIFFAMGIGMSLPWLLIVAWPGLAQRLPRPGRWMNHLRVVLGLMMLGSALWLVSLLTIHIGRTPVLTLLVILAIALLVATAWRYRWRTALRAGALAIVVAGAVAFVAQQDGQGPRRDRVNWQPLSEQAIASALAEHKRVFIDVTADWCVTCKANKYNVLLRDDVQQALLAPDVVALRGDWSRPSADISQFLTARGSAAVPFNQIYGPELPQGQILPALLDREHLLATLSAAKGK

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

4 GO

Gene Ontology (GO)

4
  • GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
  • GO:0015035 Catalysis of the reaction: a protein with reduced sulfide groups = a protein with oxidized disulfide bonds.
  • GO:0045454 Any process that maintains the redox environment of a cell or compartment within a cell.
  • GO:0017004 The aggregation, arrangement and bonding together of a cytochrome complex. A cytochrome complex is a protein complex in which at least one of the proteins is a cytochrome, i.e. a heme-containing protein involved in catalysis of redox reactions.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

42 records
Show feature table
Start End DB Term Name
474 496 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
499 517 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
494 498 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
1 22 SignalP_GRAM_POSITIVE SignalP-TM SignalP-TM
1 22 SignalP_EUK SignalP-noTM SignalP-noTM
1 22 Phobius SIGNAL_PEPTIDE Signal peptide region
561 663 CDD cd02953 DsbDgamma
561 663 InterPro IPR035671 DsbD gamma
380 399 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
399 421 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
474 493 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
543 669 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
431 453 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
556 642 Pfam PF13899 Thioredoxin-like
319 341 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
299 318 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
454 473 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
524 543 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
518 523 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
575 593 ProSitePatterns PS00194 Thioredoxin family active site.
575 593 InterPro IPR017937 Thioredoxin, conserved site
357 379 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
545 650 Gene3D G3DSA:3.40.30.10 Glutaredoxin
23 271 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
276 298 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
1 7 Phobius SIGNAL_PEPTIDE_N_REGION N-terminal region of a signal peptide.
552 662 SUPERFAMILY SSF52833 Thioredoxin-like
552 662 InterPro IPR036249 Thioredoxin-like superfamily
400 427 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
356 378 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
3 666 PANTHER PTHR32234 THIOL:DISULFIDE INTERCHANGE PROTEIN DSBD
524 542 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
500 517 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
18 22 Phobius SIGNAL_PEPTIDE_C_REGION C-terminal region of a signal peptide.
8 17 Phobius SIGNAL_PEPTIDE_H_REGION Hydrophobic region of a signal peptide.
433 453 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
272 298 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
428 432 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
319 337 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
338 356 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
43 145 Pfam PF11412 Disulphide bond corrector protein DsbC
43 145 InterPro IPR028250 Thiol:disulfide interchange protein DsbD, N-terminal domain

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · FPocket

Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Site 1 FPocket #73
0.999
Likely same site as P2Rank 2 4.1 Å 16 shared residues 100% of smaller site
Unusual size
Show in viewer
Surrounding area
Site 2 FPocket #54
0.45
Show in viewer
Surrounding area

Binding pockets · P2Rank

Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Site 1 P2Rank #1
0.588
Show in viewer
Surrounding area
Site 2 P2Rank #2
0.412
Likely same site as FPocket 73 4.1 Å 16 shared residues 100% of smaller site
Show in viewer
Surrounding area
Site 3 P2Rank #3
0.236
Show in viewer
Surrounding area
Site 4 P2Rank #4
0.169
Show in viewer
Surrounding area
Site 5 P2Rank #5
0.141
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GV62
AlphaFold DB full sequence Viewing
ColabFold VK055_4150
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

1 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 1 records from similar proteins
Structural ligands 1 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 0 similarity-based ZINC candidates
Best available ligand signal
DTT PDB via homolog 154.3 Da · LogP -0.43 · TPSA 40.5 Open detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
DTT RCSB PDB P36655 154.3 Da LogP -0.43 TPSA 40.5 ✓ Ro5 ✓ Clean C([C@@H]([C@H](CS)O)O)S

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.