Protein target profile

VK055_4155

channel, hemolysin III family protein

Genome: KpATCC43816 Gene: AIK82701.1 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GV54
Length 219
Pocket druggability 0.997
Functional annotation 0 EC 4 GO
Target summary

Target candidate with partial support; inspect missing evidence before prioritizing.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
32.864 Lower values reduce human off-target concern.
Human E-value
3.04e-26
Gut microbiome similarity
2.3% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
33.775 Higher values support similarity to known essential genes.

Localization

Localization
CytoplasmicMembrane

Structure confidence

ColabFold pLDDT
92.82 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

The selected pocket score is the FPocket value used for ranking after applying the curated structure priority. It estimates small-molecule pocket quality; it is not experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

FPocket 0.997
Structure A0A0H3GV54
Pocket Pocket 1
P2Rank 0.985
Structure A0A0H3GV54
Pocket Pocket 1
ColabFold model
FPocket 0.998 · Pocket 1
P2Rank 0.969 · Pocket 1
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 110 / 4744 genomes with a hit
Prevalence 2.3%

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Sequence

Primary amino-acid sequence viewer.

MVRKPLITQGYSLAEEVANSISHGIGLVFGIVGLVLLLVQAADTNASATAIASYSLYGGSMIMLFLASTLYHAIPHQRAKQWLKKFDHCAIYLLIAGTYTPFLLVGLNSPLAKGLMIVIWSLALLGILFKLTIAHRFKILSLVTYLTMGWLSLIVVYQLAVKLAVGGVTLLAVGGVVYSLGVIFYVCKRIPYNHAIWHGFVLGGSVCHFLAIYLYIGQS

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

4 GO

Gene Ontology (GO)

4
  • GO:0140911 An activity in which a protein is inserted into the membrane of another cell where it forms transmembrane pores. Pores disrupts the integrity of the cell membrane, resulting in deregulated ion homeostasis, cellular dysfunction, and can result in cell death.
  • GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
  • GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
  • GO:0046872 Binding to a metal ion.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

28 records
Show feature table
Start End DB Term Name
21 42 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
111 132 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
165 187 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
54 74 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
139 157 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
163 186 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
106 110 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
133 138 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
217 219 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
194 216 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
15 216 NCBIfam TIGR01065 hemolysin III family protein
15 216 InterPro IPR005744 Hly-III
12 209 Pfam PF03006 Haemolysin-III related
12 209 InterPro IPR004254 AdipoR/Haemolysin-III-related
20 42 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
115 134 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
89 111 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
75 85 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
195 216 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
158 162 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
1 20 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
46 68 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
187 194 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
139 161 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
86 105 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
11 215 PANTHER PTHR20855 ADIPOR/PROGESTIN RECEPTOR-RELATED
11 215 InterPro IPR004254 AdipoR/Haemolysin-III-related
43 53 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · FPocket

Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Site 1 FPocket #1
0.997
Likely same site as P2Rank 1 0.9 Å 43 shared residues 93% of smaller site
Unusual size
Show in viewer
Surrounding area

Binding pockets · P2Rank

Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Site 1 P2Rank #1
0.985
Likely same site as FPocket 1 0.9 Å 43 shared residues 93% of smaller site
Show in viewer
Surrounding area
Site 2 P2Rank #2
0.034
Show in viewer
Surrounding area
Site 3 P2Rank #3
0.001
Show in viewer
Surrounding area
Residue sets
UniProt: Binding site:194-194
UniProt: Binding site:198-198
UniProt: Binding site:72-72
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GV54
AlphaFold DB full sequence Viewing
ColabFold VK055_4155
ColabFold full sequence Loaded