KpATCC43816 Protein target profile

isopentenyl-diphosphate delta-isomerase

Accession: VK055_4165

Gene: idi AIK82711.1 3D evidence: AlphaFold DB model + ColabFold model Metabolism 1 reaction UniProt A0A0H3GV42
Length 184
Pocket druggability (P2Rank · AlphaFold DB model) 0.883
Metabolic reactions 1
Chokepoint No
Direct ligand evidence 0 17 total records
Functional annotation 1 EC 5 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
34.568 Lower values reduce human off-target concern.
Human E-value
8.51e-10
Gut microbiome similarity
1.4% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
0.0 Higher values support similarity to known essential genes.

Structure confidence

ColabFold pLDDT
96.95 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.883
Structure A0A0H3GV42
Pocket Pocket 1
Druggability (FPocket) 0.704
Structure A0A0H3GV42
Pocket Pocket 1
ColabFold model
P2Rank 0.899 · Pocket 1
FPocket 0.602 · Pocket 1
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 68 / 4744 genomes with a hit
Prevalence 1.4%

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

Explore metabolic network

Metabolic context: more central than 88.9% of genes in this genome.

Relative network centrality 88.9% more central than 88.9% of genes in this genome
Chokepoint Not a chokepoint
Catalyzed reaction

1 reaction mapped to this gene in the metabolic model. Open the full network to see each one, with substrates/products and the reaction-reaction map.

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MAGEHVILLDEQDQPAGMLEKYAAHTFDTPLHLAFSCWLFNQQGQLLVTRRSLGKKAWPGVWTNSVCGHPQQGETFEQAVTRRCRFELGVEISDIAPVHPAFRYRAVAPNGIVENEVCPVYAARVVSEVQPNDDEVMDYQWVDLATMLSALAATPWAFSPWMVLEAENRDARQALTDFVARLRG

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 5 GO

Subcellular localization

Localization
Cytoplasmic

Enzyme Commission (EC)

1

Gene Ontology (GO)

5
  • GO:0004452 Catalysis of the reaction: isopentenyl diphosphate = dimethylallyl diphosphate.
  • GO:0008299 The chemical reactions and pathways resulting in the formation of an isoprenoid compound, isoprene (2-methylbuta-1,3-diene) or compounds containing or derived from linked isoprene (3-methyl-2-butenylene) residues.
  • GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
  • GO:0046872 Binding to a metal ion.
  • GO:0050992 The chemical reactions and pathways resulting in the formation of dimethylallyl diphosphate.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

17 records
Show feature table
Start End DB Term Name
4 177 Hamap MF_00202 Isopentenyl-diphosphate Delta-isomerase [idi].
4 177 InterPro IPR011876 Isopentenyl-diphosphate delta-isomerase, type 1
4 168 PANTHER PTHR10885 ISOPENTENYL-DIPHOSPHATE DELTA-ISOMERASE
6 164 NCBIfam TIGR02150 isopentenyl-diphosphate delta-isomerase
6 164 InterPro IPR011876 Isopentenyl-diphosphate delta-isomerase, type 1
1 181 FunFam G3DSA:3.90.79.10:FF:000009 Isopentenyl-diphosphate Delta-isomerase
2 183 Gene3D G3DSA:3.90.79.10 Nucleoside Triphosphate Pyrophosphohydrolase
30 164 ProSiteProfiles PS51462 Nudix hydrolase domain profile.
30 164 InterPro IPR000086 NUDIX hydrolase domain
31 161 Pfam PF00293 NUDIX domain
31 161 InterPro IPR000086 NUDIX hydrolase domain
1 181 PIRSF PIRSF018427 Isopentenyldiphpt_isom
1 181 InterPro IPR011876 Isopentenyl-diphosphate delta-isomerase, type 1
4 167 SUPERFAMILY SSF55811 Nudix
4 167 InterPro IPR015797 NUDIX hydrolase-like domain superfamily
4 167 CDD cd02885 IPP_Isomerase
4 167 InterPro IPR011876 Isopentenyl-diphosphate delta-isomerase, type 1

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.883
Likely same site as FPocket 1 1.8 Å 15 shared residues 100% of smaller site
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.066
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #1
0.704 Unusual size
Likely same site as P2Rank 1 1.8 Å 15 shared residues 100% of smaller site
Show in viewer
Surrounding area
Residue sets
UniProt: Active site:116-116
UniProt: Active site:67-67
UniProt: Binding site:114-114
UniProt: Binding site:116-116
UniProt: Binding site:25-25
UniProt: Binding site:32-32
UniProt: Binding site:69-69
UniProt: Binding site:87-87
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GV42
AlphaFold DB full sequence Viewing
ColabFold VK055_4165
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

17 records
Chemistry signal

Structural and bioactivity evidence are both available for this target.

Direct evidence 0 same-protein records
Transferred evidence 10 records from similar proteins
Structural ligands 8 0 loaded crystals
Measured bioactivity 2 direct and transferred ChEMBL records
Proposed compounds 7 similarity-based ZINC candidates
Best available ligand signal
BHI PDB via homolog 343.0 Da · LogP 0.75 · TPSA 133.5 Open detail RCSB PDB
DED PDB via homolog Detail RCSB PDB
DMA PDB via homolog Detail RCSB PDB
DPO PDB via homolog Detail RCSB PDB
EA2 PDB via homolog Detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
BHI RCSB PDB Q46822 343.0 Da LogP 0.75 TPSA 133.5 ✓ Ro5 ✓ Clean C[C@@](CCO[P@](=O)(O)OP(=O)(O)O)(CBr)O
DED RCSB PDB Q46822 249.1 Da LogP -0.23 TPSA 116.5 ✓ Ro5 ✓ Clean CN(C)CCO[P@@](=O)(O)OP(=O)(O)O
DMA RCSB PDB Q13907-2 246.1 Da LogP 1.18 TPSA 113.3 ✓ Ro5 ✓ Clean CC(=CCO[P@@](=O)(O)OP(=O)(O)O)C
DPO RCSB PDB Q46822 173.9 Da LogP -3.34 TPSA 135.6 ✓ Ro5 ✓ Clean [O-]P(=O)([O-])OP(=O)([O-])[O-]
EA2 RCSB PDB Q13907 221.0 Da LogP -0.83 TPSA 139.3 ✓ Ro5 ✓ Clean C(CO[P@@](=O)(O)OP(=O)(O)O)N
EIP RCSB PDB Q46822 264.1 Da LogP 0.23 TPSA 133.5 ✓ Ro5 ✓ Clean C[C@@H](CCO[P@](=O)(O)OP(=O)(O)O)CO
POP RCSB PDB Q9BXS1 176.0 Da LogP -2.08 TPSA 129.9 ✓ Ro5 ✓ Clean O[P@@](=O)([O-])O[P@@](=O)(O)[O-]
SBH RCSB PDB Q46822 343.0 Da LogP 0.75 TPSA 133.5 ✓ Ro5 ✓ Clean C[C@](CCO[P@@](=O)(O)OP(=O)(O)O)(CBr)O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.