Protein target profile

VK055_4239

high-affinity nickel-transport family protein

Genome: KpATCC43816 Gene: AIK82783.1 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3H2H5
Length 318
Pocket druggability 0.996
Functional annotation 0 EC 7 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
0.9% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
33.455 Higher values support similarity to known essential genes.

Localization

Localization
CytoplasmicMembrane

Structure confidence

ColabFold pLDDT
81.27 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

The selected pocket score is the FPocket value used for ranking after applying the curated structure priority. It estimates small-molecule pocket quality; it is not experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

FPocket 0.996
Structure A0A0H3H2H5
Pocket Pocket 25
P2Rank 0.855
Structure A0A0H3H2H5
Pocket Pocket 1
ColabFold model
FPocket 0.936 · Pocket 23
P2Rank 0.858 · Pocket 1
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 41 / 4744 genomes with a hit
Prevalence 0.9%

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Sequence

Primary amino-acid sequence viewer.

MTTPIALRDWRLLAAGCGGLLLLAAAITLHSHWGDFLQWCLATQITLHRYLVMYLLLLNNHQYSGGIWLLVGAFLYGVLHAVGPGHGKFIVTTYLSTNQESLTAARVVPFLGSLLQGVTAILFVFILAVGLNLAAGDLSASRWYVEKISALTIGVFGAYVIFRALQSLWPTKQVIRRLTPAHQHDASCGCGHHGVGQDLQGADWKTRLGVVLAIGVRPCSGAIMILLFANALGIVSWGIAAVMSMALGTALSILGLSLLVHYARHRTVKRLATNHRPRPWLVPLMKILGGLALILFAVGLFFSVVPISANGDFIAAGC

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

7 GO

Gene Ontology (GO)

7
  • GO:0035444 The directed movement of nickel (Ni) cations across a membrane by means of some agent such as a transporter or pore.
  • GO:0015099 Enables the transfer of nickel (Ni) cations from one side of a membrane to the other.
  • GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
  • GO:0046583 Enables the transfer of a cation or cations from the inside of the cell to the outside of the cell across a membrane.
  • GO:0006824 The directed movement of cobalt (Co2+) ions into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
  • GO:0032025 Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cobalt ion (Co2+) stimulus.
  • GO:0010045 Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a nickel cation stimulus.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

27 records
Show feature table
Start End DB Term Name
107 131 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
260 279 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
87 106 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
237 259 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
67 173 Pfam PF03824 High-affinity nickel-transport protein
67 173 InterPro IPR011541 Nickel/cobalt transporter, high-affinity
132 142 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
280 302 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
234 259 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
1 42 Phobius SIGNAL_PEPTIDE Signal peptide region
66 86 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
229 233 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
163 207 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
43 65 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
210 232 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
108 130 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
140 162 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
12 34 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
25 42 Phobius SIGNAL_PEPTIDE_C_REGION C-terminal region of a signal peptide.
143 162 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
303 318 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
280 302 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
65 87 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
36 304 PANTHER PTHR40659 NICKEL/COBALT EFFLUX SYSTEM RCNA
1 11 Phobius SIGNAL_PEPTIDE_N_REGION N-terminal region of a signal peptide.
208 228 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
12 24 Phobius SIGNAL_PEPTIDE_H_REGION Hydrophobic region of a signal peptide.

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · FPocket

Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Site 1 FPocket #25
0.996
Likely same site as P2Rank 3 3.1 Å 15 shared residues 100% of smaller site
Unusual size
Show in viewer
Surrounding area
Site 2 FPocket #5
0.448
Show in viewer
Surrounding area
Site 3 FPocket #18
0.432
Show in viewer
Surrounding area
Site 4 FPocket #21
0.309
Show in viewer
Surrounding area

Binding pockets · P2Rank

Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Site 1 P2Rank #1
0.855
Show in viewer
Surrounding area
Site 2 P2Rank #2
0.442
Likely same site as FPocket 25 6.5 Å 9 shared residues 100% of smaller site
Show in viewer
Surrounding area
Site 3 P2Rank #3
0.112
Likely same site as FPocket 25 3.1 Å 15 shared residues 100% of smaller site
Show in viewer
Surrounding area
Site 4 P2Rank #4
0.054
Show in viewer
Surrounding area
Site 5 P2Rank #5
0.032
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3H2H5
AlphaFold DB full sequence Viewing
ColabFold VK055_4239
ColabFold full sequence Loaded