Target candidate with partial support; inspect missing evidence before prioritizing.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Evidence coverage
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- Hit
- Human identity (%)
- 61.039 Lower values reduce human off-target concern.
- Human E-value
- 1.05e-134
- Gut microbiome similarity
- 0.5% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- Y
- DEG identity (%)
- 43.434 Higher values support similarity to known essential genes.
- DEG E-value
- 2.17e-62 Smaller values mean stronger essential-gene similarity.
Localization
- Localization
- Cytoplasmic
Structure confidence
- ColabFold pLDDT
- 97.35 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelThe selected pocket score is the FPocket value used for ranking after applying the curated structure priority. It estimates small-molecule pocket quality; it is not experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.
Sequence
Pathways
Sequence
Primary amino-acid sequence viewer.
MDNLFHQPQGGNEMPRFAGRATMMRLQFIEDLQGLDAAFVGIPLDIGTSQRSGTRYGPRYIRAESVMIRPYNMATGAAPFDSLSVADIGDVPINTYSLLKSVQIIEDYYTGLNSYPLIPLTLGGDHTITLPILRALTKKHGPVGLIHVDAHTDTNDEMFGEKIAHGTTFRRAVEEGLLDLKRVVQIGQRAQGYAAGDFQWGVDQGFRLVQAEQCWHTSLAPLMAEVRQQMGNGPVYLSFDIDSLDPIWAPGTGTPEVGGLSSIQALEIVRGCRGLNLIGADLVEVSPPYDVSGNTSQLAANLLYEMLCVLPGVKYA
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Enzyme Commission (EC)
1Gene Ontology (GO)
5- GO:0016813 Catalysis of the hydrolysis of any non-peptide carbon-nitrogen bond in a linear amidine, a compound of the form R-C(=NH)-NH2.
- GO:0046872 Binding to a metal ion.
- GO:0008783 Catalysis of the reaction: agmatine + H2O = putrescine + urea.
- GO:0047971 Catalysis of the reaction: 4-guanidinobutanoate + H2O = 4-aminobutanoate + urea.
- GO:0033389 The chemical reactions and pathways resulting in the formation of putrescine, 1,4-diaminobutane, from arginine via agmatine.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 2 | 316 | FunFam | G3DSA:3.40.800.10:FF:000002 | Agmatinase |
| 6 | 311 | PANTHER | PTHR11358 | ARGINASE/AGMATINASE |
| 6 | 311 | InterPro | IPR006035 | Ureohydrolase |
| 36 | 307 | Pfam | PF00491 | Arginase family |
| 36 | 307 | InterPro | IPR006035 | Ureohydrolase |
| 25 | 316 | ProSiteProfiles | PS51409 | Arginase family profile. |
| 25 | 316 | InterPro | IPR006035 | Ureohydrolase |
| 14 | 309 | SUPERFAMILY | SSF52768 | Arginase/deacetylase |
| 14 | 309 | InterPro | IPR023696 | Ureohydrolase domain superfamily |
| 36 | 308 | NCBIfam | TIGR01230 | agmatinase |
| 36 | 308 | InterPro | IPR005925 | Agmatinase-related |
| 122 | 137 | PRINTS | PR00116 | Arginase signature |
| 122 | 137 | InterPro | IPR006035 | Ureohydrolase |
| 235 | 264 | PRINTS | PR00116 | Arginase signature |
| 235 | 264 | InterPro | IPR006035 | Ureohydrolase |
| 19 | 307 | CDD | cd11592 | Agmatinase_PAH |
| 238 | 259 | ProSitePatterns | PS01053 | Arginase family signature. |
| 238 | 259 | InterPro | IPR020855 | Ureohydrolase, manganese-binding site |
| 13 | 313 | PIRSF | PIRSF036979 | Arginase |
| 13 | 313 | InterPro | IPR006035 | Ureohydrolase |
| 2 | 316 | Gene3D | G3DSA:3.40.800.10 | Ureohydrolase domain |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · FPocket
Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A2X1SLB6
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
VK055_4548
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural ligand evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| 16D RCSB PDB | Q9I6K2 | 116.2 Da LogP 0.46 TPSA 52.0 | ✓ Ro5 | ✓ Clean |
C(CCCN)CCN
|
|
| CAC RCSB PDB | P42068 | 137.0 Da LogP -0.52 TPSA 40.1 | ✓ Ro5 | ✓ Clean |
C[As](=O)(C)[O-]
|
|
| ORN RCSB PDB | G7JFU5 | 132.2 Da LogP -0.86 TPSA 89.3 | ✓ Ro5 | ✓ Clean |
C(C[C@@H](C(=O)O)N)CN
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC1685531 ZINC | 1.000 | 200.4 Da LogP 2.80 TPSA 52.0 | ✓ Ro5 | ✓ Clean |
NCCCCCCCCCCCCN
|
| ZINC34273707 ZINC | 1.000 | 256.5 Da LogP 4.37 TPSA 52.0 | ✓ Ro5 | ✓ Clean |
NCCCCCCCCCCCCCCCCN
|
| ZINC5178646 ZINC | 1.000 | 228.4 Da LogP 3.59 TPSA 52.0 | ✓ Ro5 | ✓ Clean |
NCCCCCCCCCCCCCCN
|
| ZINC3055005 ZINC | 0.750 | 204.2 Da LogP -0.63 TPSA 126.6 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCCC[C@H](N)C(=O)O)C(=O)O
|
| ZINC3055007 ZINC | 0.750 | 204.2 Da LogP -0.63 TPSA 126.6 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCCC[C@@H](N)C(=O)O)C(=O)O
|
| ZINC3055010 ZINC | 0.750 | 204.2 Da LogP -0.63 TPSA 126.6 | ✓ Ro5 | ✓ Clean |
N[C@H](CCCC[C@@H](N)C(=O)O)C(=O)O
|
| ZINC1555366 ZINC | 0.714 | 232.3 Da LogP 0.15 TPSA 126.6 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCCCCC[C@H](N)C(=O)O)C(=O)O
|
| ZINC1555367 ZINC | 0.714 | 232.3 Da LogP 0.15 TPSA 126.6 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCCCCC[C@@H](N)C(=O)O)C(=O)O
|
| ZINC1555369 ZINC | 0.714 | 232.3 Da LogP 0.15 TPSA 126.6 | ✓ Ro5 | ✓ Clean |
N[C@H](CCCCCC[C@@H](N)C(=O)O)C(=O)O
|
| ZINC1720127 ZINC | 0.714 | 218.3 Da LogP -0.24 TPSA 126.6 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCCCC[C@H](N)C(=O)O)C(=O)O
|
| ZINC1720128 ZINC | 0.714 | 218.3 Da LogP -0.24 TPSA 126.6 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCCCC[C@@H](N)C(=O)O)C(=O)O
|
| ZINC1720130 ZINC | 0.714 | 218.3 Da LogP -0.24 TPSA 126.6 | ✓ Ro5 | ✓ Clean |
N[C@H](CCCCC[C@@H](N)C(=O)O)C(=O)O
|
| ZINC5113207 ZINC | 0.667 | 217.3 Da LogP -0.10 TPSA 101.4 | ✓ Ro5 | ✓ Clean |
NCCCCNCCCC[C@H](N)C(=O)O
|
| ZINC1545440 ZINC | 0.615 | 213.4 Da LogP 4.65 TPSA 26.0 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCCN
|
| ZINC2385445 ZINC | 0.615 | 201.4 Da LogP 2.84 TPSA 46.2 | ✓ Ro5 | ✓ Clean |
NCCCCCCCCCCCCO
|
| ZINC34196183 ZINC | 0.615 | 229.4 Da LogP 3.62 TPSA 46.2 | ✓ Ro5 | ✓ Clean |
NCCCCCCCCCCCCCCO
|
| ZINC38585283 ZINC | 0.615 | 203.4 Da LogP 3.39 TPSA 26.0 | ✓ Ro5 | ✓ Clean |
NCCCCCCCCCCCS
|
| ZINC2561080 ZINC | 0.586 | 246.3 Da LogP -1.64 TPSA 144.5 | ✓ Ro5 | ✓ Clean |
NCCC[C@H](N)C(=O)N[C@@H](CCCN)C(=O)O
|
| ZINC15261541 ZINC | 0.581 | 261.3 Da LogP -1.51 TPSA 155.7 | ✓ Ro5 | ✓ Clean |
NCCC[C@H](NC(=O)CC[C@H](N)C(=O)O)C(=O)O
|
| ZINC1570993 ZINC | 0.577 | 215.3 Da LogP 2.93 TPSA 63.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCC[C@H](N)C(=O)O
|
| ZINC1570999 ZINC | 0.577 | 229.4 Da LogP 3.32 TPSA 63.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCC[C@H](N)C(=O)O
|
| ZINC1620974 ZINC | 0.577 | 243.4 Da LogP 3.71 TPSA 63.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCC[C@H](N)C(=O)O
|
| ZINC1742220 ZINC | 0.577 | 201.3 Da LogP 2.54 TPSA 63.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCCC[C@H](N)C(=O)O
|
| ZINC2035155 ZINC | 0.577 | 215.3 Da LogP 2.93 TPSA 63.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCC[C@@H](N)C(=O)O
|
| ZINC2035157 ZINC | 0.577 | 201.3 Da LogP 2.54 TPSA 63.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCCC[C@@H](N)C(=O)O
|
| ZINC2037129 ZINC | 0.577 | 243.4 Da LogP 3.71 TPSA 63.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCC[C@@H](N)C(=O)O
|
| ZINC2106542 ZINC | 0.577 | 245.3 Da LogP 1.99 TPSA 100.6 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCCCCCCCCC(=O)O)C(=O)O
|
| ZINC2106543 ZINC | 0.577 | 245.3 Da LogP 1.99 TPSA 100.6 | ✓ Ro5 | ✓ Clean |
N[C@H](CCCCCCCCCC(=O)O)C(=O)O
|
| ZINC2108713 ZINC | 0.577 | 217.3 Da LogP 1.21 TPSA 100.6 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCCCCCCC(=O)O)C(=O)O
|
| ZINC2108714 ZINC | 0.577 | 217.3 Da LogP 1.21 TPSA 100.6 | ✓ Ro5 | ✓ Clean |
N[C@H](CCCCCCCC(=O)O)C(=O)O
|
| ZINC43531622 ZINC | 0.577 | 271.4 Da LogP 4.49 TPSA 63.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCC[C@H](N)C(=O)O
|
| ZINC43531626 ZINC | 0.577 | 271.4 Da LogP 4.49 TPSA 63.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCC[C@@H](N)C(=O)O
|
| ZINC5113209 ZINC | 0.577 | 275.3 Da LogP -0.26 TPSA 138.7 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCCCNCCCC[C@H](N)C(=O)O)C(=O)O
|
| ZINC8437446 ZINC | 0.577 | 229.4 Da LogP 3.32 TPSA 63.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCC[C@@H](N)C(=O)O
|
| ZINC1598087 ZINC | 0.571 | 215.4 Da LogP 1.61 TPSA 64.1 | ✓ Ro5 | ✓ Clean |
NCCCCCCNCCCCCCN
|
| ZINC205048564 ZINC | 0.548 | 260.3 Da LogP -1.25 TPSA 144.5 | ✓ Ro5 | ✓ Clean |
NCCCC[C@H](N)C(=O)N[C@@H](CCCN)C(=O)O
|
| ZINC4899571 ZINC | 0.548 | 360.5 Da LogP -2.42 TPSA 199.6 | 1 viol. | ✓ Clean |
NCCC[C@H](N)C(=O)N[C@@H](CCCN)C(=O)N[C@@H](CCCN…
|
| ZINC20112808 ZINC | 0.536 | 211.2 Da LogP -0.25 TPSA 120.9 | ✓ Ro5 | ✓ Clean |
N[C@H](CCCCP(=O)(O)O)C(=O)O
|
| ZINC2169486 ZINC | 0.536 | 211.2 Da LogP -0.25 TPSA 120.9 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCCCP(=O)(O)O)C(=O)O
|
| ZINC1856281 ZINC | 0.517 | 225.2 Da LogP 0.14 TPSA 120.9 | ✓ Ro5 | ✓ Clean |
N[C@H](CCCCCP(=O)(O)O)C(=O)O
|
| ZINC19364679 ZINC | 0.517 | 233.3 Da LogP -1.43 TPSA 138.7 | ✓ Ro5 | ✓ Clean |
N[C@@H](CNCCCC[C@@H](N)C(=O)O)C(=O)O
|
| ZINC2139781 ZINC | 0.517 | 269.2 Da LogP -0.41 TPSA 158.2 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCCC[C@@H](C(=O)O)P(=O)(O)O)C(=O)O
|
| ZINC2139783 ZINC | 0.517 | 269.2 Da LogP -0.41 TPSA 158.2 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCCC[C@H](C(=O)O)P(=O)(O)O)C(=O)O
|
| ZINC2139784 ZINC | 0.517 | 269.2 Da LogP -0.41 TPSA 158.2 | ✓ Ro5 | ✓ Clean |
N[C@H](CCCC[C@@H](C(=O)O)P(=O)(O)O)C(=O)O
|
| ZINC2139785 ZINC | 0.517 | 269.2 Da LogP -0.41 TPSA 158.2 | ✓ Ro5 | ✓ Clean |
N[C@H](CCCC[C@H](C(=O)O)P(=O)(O)O)C(=O)O
|
| ZINC2149821 ZINC | 0.517 | 239.2 Da LogP 0.53 TPSA 120.9 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCCCCCP(=O)(O)O)C(=O)O
|
| ZINC2149823 ZINC | 0.517 | 239.2 Da LogP 0.53 TPSA 120.9 | ✓ Ro5 | ✓ Clean |
N[C@H](CCCCCCP(=O)(O)O)C(=O)O
|
| ZINC2516019 ZINC | 0.517 | 225.2 Da LogP 0.14 TPSA 120.9 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCCCCP(=O)(O)O)C(=O)O
|
| ZINC95621421 ZINC | 0.517 | 233.3 Da LogP -1.43 TPSA 138.7 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCCCNC[C@H](N)C(=O)O)C(=O)O
|
| ZINC95621422 ZINC | 0.517 | 233.3 Da LogP -1.43 TPSA 138.7 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCCCNC[C@@H](N)C(=O)O)C(=O)O
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.