Protein target profile

VK055_4769

mntH manganese ion transporter

Genome: KpATCC43816 Gene: AIK83297.1 mntH 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GTA3
Length 392
Pocket druggability 0.985
Direct ligand evidence 0 85 total records
Functional annotation 0 EC 9 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
46.377 Lower values reduce human off-target concern.
Human E-value
4.91e-17
Gut microbiome similarity
2.7% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
41.514 Higher values support similarity to known essential genes.
DEG E-value
4.15e-89 Smaller values mean stronger essential-gene similarity.

Localization

Localization
CytoplasmicMembrane

Structure confidence

ColabFold pLDDT
82.18 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

The selected pocket score is the FPocket value used for ranking after applying the curated structure priority. It estimates small-molecule pocket quality; it is not experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

FPocket 0.985
Structure A0A0H3GTA3
Pocket Pocket 2
P2Rank 0.846
Structure A0A0H3GTA3
Pocket Pocket 1
ColabFold model
FPocket 0.713 · Pocket 24
P2Rank 0.371 · Pocket 1
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 129 / 4744 genomes with a hit
Prevalence 2.7%

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Sequence

Primary amino-acid sequence viewer.

MGPAFVAAIGYIDPGNFATNIQAGASFGYQLLWVVVWANLMAMLIQVLSAKLGIATGKNLAEQIRDHYPRPVVWFYWVQAEIIAMATDLAEFIGAAIGFKLVLGVSLLQGAVLTGVATFLILMLQRRGQKPLEKVIGGLLLFVAVAYVVELIFSQPALAPLTKGLVIPTLPNGEAVFLAAGVLGATIMPHVIYLHSSLTQHLHGGTRKERYNATRWDVAIAMTIAGFVNLAMMATAAAAFHFNGHTGVADLDQAYMTLEPLLSHAAATIFGLSLIAAGLSSTVVGTLAGQVVMQGFIRFHIPLWFRRAITMLPSFVVILLGLDPTRILVMSQVLLSFGIALALVPLLIFTSNAKLMGDLVNTRWVRGIGWAIVAIVVSLNGWLIVGSLLGVD

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

9 GO

Gene Ontology (GO)

9
  • GO:0046873 Enables the transfer of metal ions from one side of a membrane to the other.
  • GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
  • GO:0030001 The directed movement of metal ions, any metal ion with an electric charge, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
  • GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
  • GO:0015086 Enables the transfer of cadmium (Cd) ions from one side of a membrane to the other.
  • GO:0005384 Enables the transfer of manganese (Mn) ions from one side of a membrane to the other.
  • GO:0046872 Binding to a metal ion.
  • GO:0015293 Enables the active transport of a solute across a membrane by a mechanism whereby two or more species are transported together in the same direction in a tightly coupled process not directly linked to a form of energy other than chemiosmotic energy.
  • GO:0034755 A process in which an iron ion is transported from one side of a membrane to the other by means of some agent such as a transporter or pore.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

50 records
Show feature table
Start End DB Term Name
1 388 Hamap MF_00221 Divalent metal cation transporter MntH [mntH].
1 388 InterPro IPR001046 NRAMP family
196 215 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
1 389 PANTHER PTHR11706 SOLUTE CARRIER PROTEIN FAMILY 11 MEMBER
1 389 InterPro IPR001046 NRAMP family
103 124 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
31 54 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
303 322 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
370 391 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
136 155 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
175 195 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
327 349 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
304 322 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
323 327 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
392 392 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
278 297 PRINTS PR00447 Natural resistance-associated macrophage protein signature
278 297 InterPro IPR001046 NRAMP family
129 150 PRINTS PR00447 Natural resistance-associated macrophage protein signature
129 150 InterPro IPR001046 NRAMP family
179 202 PRINTS PR00447 Natural resistance-associated macrophage protein signature
179 202 InterPro IPR001046 NRAMP family
104 123 PRINTS PR00447 Natural resistance-associated macrophage protein signature
104 123 InterPro IPR001046 NRAMP family
76 102 PRINTS PR00447 Natural resistance-associated macrophage protein signature
76 102 InterPro IPR001046 NRAMP family
98 102 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
1 356 NCBIfam TIGR01197 metal ion transporter, metal ion (Mn2+/Fe2+) transporter (Nramp) family
1 356 InterPro IPR001046 NRAMP family
125 135 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
175 197 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
218 240 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
350 369 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
243 261 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
293 303 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
262 292 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
17 362 Pfam PF01566 Natural resistance-associated macrophage protein
17 362 InterPro IPR001046 NRAMP family
74 97 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
136 155 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
33 55 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
260 282 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
55 73 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
102 124 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
2 355 NCBIfam NF037982 Nramp family divalent metal transporter
156 174 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
1 30 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
216 242 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
328 349 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
369 391 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
75 97 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · FPocket

Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Site 1 FPocket #2
0.985
Likely same site as P2Rank 1 2.3 Å 28 shared residues 93% of smaller site
Unusual size
Show in viewer
Surrounding area
Site 2 FPocket #32
0.444
Likely same site as P2Rank 2 6.7 Å 5 shared residues 50% of smaller site
Show in viewer
Surrounding area

Binding pockets · P2Rank

Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Site 1 P2Rank #1
0.846
Likely same site as FPocket 2 2.3 Å 28 shared residues 93% of smaller site
Show in viewer
Surrounding area
Site 2 P2Rank #2
0.513
Likely same site as FPocket 32 6.7 Å 5 shared residues 50% of smaller site
Show in viewer
Surrounding area
Site 3 P2Rank #3
0.107
Show in viewer
Surrounding area
Site 4 P2Rank #4
0.044
Show in viewer
Surrounding area
Site 5 P2Rank #5
0.039
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GTA3
AlphaFold DB full sequence Viewing
ColabFold VK055_4769
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

85 records
Chemistry signal

Structural and bioactivity evidence are both available for this target.

Direct evidence 0 same-protein records
Transferred evidence 35 records from similar proteins
Structural ligands 3 0 loaded crystals
Measured bioactivity 32 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
DMU PDB via homolog 482.6 Da · LogP -1.23 · TPSA 178.5 Open detail RCSB PDB
NJZ PDB via homolog Detail RCSB PDB
OLC PDB via homolog Detail RCSB PDB
CHEMBL3145266 ChEMBL via homolog · pchembl 7.22 (~60.3 nM) Detail ChEMBL
CHEMBL2079088 ChEMBL via homolog · pchembl 6.85 (~141.3 nM) Detail ChEMBL

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
DMU RCSB PDB E4KPW4 482.6 Da LogP -1.23 TPSA 178.5 2 viol. ✓ Clean CCCCCCCCCCO[C@H]1[C@@H]([C@H]([C@@H]([C@H](O1)C…
NJZ RCSB PDB E4KPW4 333.3 Da LogP 2.70 TPSA 99.7 ✓ Ro5 ✓ Clean [H]/N=C(\SCc1cc(cc(c1)CS/C(=N/[H])/N)Br)/N
OLC RCSB PDB Q9RTP8 356.5 Da LogP 4.92 TPSA 66.8 ✓ Ro5 ✓ Clean CCCCCCCC\C=C/CCCCCCCC(=O)OC[C@@H](CO)O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.