Protein target profile
HT085_RS00225
acetyl-CoA carboxylase biotin carboxylase subunit
Target candidate with partial support; inspect missing evidence before prioritizing.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- Hit
- Gut microbiome off-target
- Hit
Essentiality
- Essential (DEG)
- Y
Localization
- Localization
- Cytoplasmic
Binding-site evidence
The selected pocket score is the FPocket value used for ranking after applying the curated structure priority. It estimates small-molecule pocket quality; it is not experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MLKKVLIANRGEIALRVLRACREMGIATVAVHSEADKGSLHVKLADESVCIGPAASAQSYLNIPAIIAAAEVTCADAVHPGYGFLAENADFAEQVEQSGFTFIGPKPDTIRLMGDKVSAKHAMIAAGVPCVPGSDGALPDDDAEILKIADKVGYPVIIKASGGGGGRGMRVVEKKEDLLQSVEMTKAEAGAAFGNPMVYMERYLQRPRHVEIQVLADEHGNAVYLAERDCSLQRRHQKVIEEAPAPFIDEEARKKIGKACTDACKRIGYRGAGTFEFLYEDGEFFFIEMNTRVQVEHPVTELITGVDIVQEQLRIASGLPLQYKQKDIKIEGHAFECRINAEDPYNFIPSPGPIESCHLPGGFGIRVDSHIYQGYRIPPYYDSLIGKICVHGKTREQAMAKMRVALAELAVTGIKTNTPLHRDLFADAGFQEGGVSIHYLEHWLEARKTKQDK
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Enzyme Commission (EC)
1Gene Ontology (GO)
4- GO:0005524 Binding to ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
- GO:0046872 Binding to a metal ion.
- GO:0004075 Catalysis of the reaction: ATP + biotin-carboxyl-carrier protein + CO2 = ADP + phosphate + carboxybiotin-carboxyl-carrier protein.
- GO:0006633 The chemical reactions and pathways resulting in the formation of a fatty acid, any of the aliphatic monocarboxylic acids that can be liberated by hydrolysis from naturally occurring fats and oils. Fatty acids are predominantly straight-chain acids of 4 to 24 carbon atoms, which may be saturated or unsaturated; branched fatty acids and hydroxy fatty acids also occur, and very long chain acids of over 30 carbons are found in waxes.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 1 | 131 | FunFam | G3DSA:3.40.50.20:FF:000010 | Propionyl-CoA carboxylase subunit alpha |
| 1 | 445 | ProSiteProfiles | PS50979 | Biotin carboxylation domain profile. |
| 1 | 445 | InterPro | IPR011764 | Biotin carboxylation domain |
| 204 | 443 | Gene3D | G3DSA:3.30.470.20 | - |
| 1 | 445 | NCBIfam | TIGR00514 | acetyl-CoA carboxylase biotin carboxylase subunit |
| 1 | 445 | InterPro | IPR004549 | Acetyl-CoA carboxylase, biotin carboxylase |
| 331 | 444 | SUPERFAMILY | SSF51246 | Rudiment single hybrid motif |
| 331 | 444 | InterPro | IPR011054 | Rudiment single hybrid motif |
| 154 | 168 | ProSitePatterns | PS00866 | Carbamoyl-phosphate synthase subdomain signature 1. |
| 154 | 168 | InterPro | IPR005479 | Carbamoyl-phosphate synthetase large subunit-like, ATP-binding domain |
| 1 | 110 | Pfam | PF00289 | Biotin carboxylase, N-terminal domain |
| 1 | 110 | InterPro | IPR005481 | Biotin carboxylase-like, N-terminal domain |
| 1 | 131 | Gene3D | G3DSA:3.40.50.20 | - |
| 120 | 317 | ProSiteProfiles | PS50975 | ATP-grasp fold profile. |
| 120 | 317 | InterPro | IPR011761 | ATP-grasp fold |
| 336 | 441 | Pfam | PF02785 | Biotin carboxylase C-terminal domain |
| 336 | 441 | InterPro | IPR005482 | Biotin carboxylase, C-terminal |
| 1 | 113 | SUPERFAMILY | SSF52440 | PreATP-grasp domain |
| 1 | 113 | InterPro | IPR016185 | Pre-ATP-grasp domain superfamily |
| 286 | 293 | ProSitePatterns | PS00867 | Carbamoyl-phosphate synthase subdomain signature 2. |
| 286 | 293 | InterPro | IPR005479 | Carbamoyl-phosphate synthetase large subunit-like, ATP-binding domain |
| 132 | 203 | Gene3D | G3DSA:3.30.1490.20 | - |
| 132 | 203 | InterPro | IPR013815 | ATP-grasp fold, subdomain 1 |
| 336 | 441 | SMART | SM00878 | Biotin_carb_C_2 |
| 83 | 347 | SUPERFAMILY | SSF56059 | Glutathione synthetase ATP-binding domain-like |
| 3 | 447 | PANTHER | PTHR48095 | PYRUVATE CARBOXYLASE SUBUNIT A |
| 115 | 322 | Pfam | PF02786 | Carbamoyl-phosphate synthase L chain, ATP binding domain |
| 115 | 322 | InterPro | IPR005479 | Carbamoyl-phosphate synthetase large subunit-like, ATP-binding domain |
| 132 | 203 | FunFam | G3DSA:3.30.1490.20:FF:000003 | acetyl-CoA carboxylase isoform X1 |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · FPocket
Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
All structural evidence
Structural evidence
0 + 1Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
HT085_RS00225
|
AlphaFold DB | — | — | full sequence | — | Viewing |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural and bioactivity evidence are both available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| 3PY RCSB PDB | Q2K340 | 104.1 Da LogP -1.37 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
C(C(=O)C(=O)O)O
|
|
| ACP RCSB PDB | P43873 | 505.2 Da LogP -1.52 TPSA 269.9 | 3 viol. | ✓ Clean |
c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
|
|
| AGS RCSB PDB | Q2K340 | 523.2 Da LogP -1.51 TPSA 262.1 | 3 viol. | ✓ Clean |
c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
|
|
| ANP RCSB PDB | Q0P8W7 | 506.2 Da LogP -2.06 TPSA 281.9 | 3 viol. | ✓ Clean |
c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
|
|
| BPV RCSB PDB | Q2K340 | 167.0 Da LogP 0.03 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
C(C(=O)C(=O)O)Br
|
|
| BTI RCSB PDB | Q2K340 | 228.3 Da LogP 0.91 TPSA 58.2 | ✓ Ro5 | ✓ Clean |
C1[C@H]2[C@@H]([C@@H](S1)CCCCC=O)NC(=O)N2
|
|
| BYT RCSB PDB | Q2K340 | 372.5 Da LogP 0.41 TPSA 133.6 | ✓ Ro5 | ✓ Clean |
C1[C@H]2[C@@H]([C@@H](S1)CCCCC(=O)NCCCC[C@@H](C…
|
|
| CAC RCSB PDB | Q0P8W7 | 137.0 Da LogP -0.52 TPSA 40.1 | ✓ Ro5 | ✓ Clean |
C[As](=O)(C)[O-]
|
|
| JZK RCSB PDB | P24182 | 396.9 Da LogP 4.98 TPSA 72.9 | ✓ Ro5 | ✓ Clean |
c1ccc(c(c1)CNc2nc3cc(ccc3n2CC4CCCCC4)C(=O)N)Cl
|
|
| JZL RCSB PDB | P24182 | 442.0 Da LogP 3.92 TPSA 119.2 | ✓ Ro5 | ✓ Clean |
c1ccc(c(c1)CNc2nc3cc(cc(c3n2C[C@@H]4CCCCC[C@@H]…
|
|
| L21 RCSB PDB | P24182 | 203.2 Da LogP 1.33 TPSA 69.6 | ✓ Ro5 | ✓ Clean |
CC(=CCn1cnc(c-2ncnc12)N)C
|
|
| L22 RCSB PDB | P24182 | 193.2 Da LogP 0.76 TPSA 90.7 | ✓ Ro5 | ✓ Clean |
c1cnc(nc1c2csc(n2)N)N
|
|
| L23 RCSB PDB | P24182 | 334.2 Da LogP 3.59 TPSA 69.6 | ✓ Ro5 | ✓ Clean |
Cc1nc(cn1Cc2c(cccc2Cl)Cl)c3ccnc(n3)N
|
|
| MLT RCSB PDB | Q0P8W7 | 134.1 Da LogP -1.09 TPSA 94.8 | ✓ Ro5 | ✓ Clean |
C([C@H](C(=O)O)O)C(=O)O
|
|
| MQM RCSB PDB | P24182 | 389.3 Da LogP 3.37 TPSA 94.0 | ✓ Ro5 | ✓ Clean |
c1cc(c(c(c1)Cl)c2cc3cnc(nc3nc2N4CC[C@H](C4)CN)N…
|
|
| MQV RCSB PDB | P43873 | 429.9 Da LogP 3.38 TPSA 106.8 | ✓ Ro5 | ✓ Clean |
c1cc(c(c(c1)Cl)c2cc3cnc(nc3nc2N4C[C@@H]5[C@H](C…
|
|
| MV4 RCSB PDB | P43873 | 356.4 Da LogP 2.96 TPSA 94.0 | ✓ Ro5 | ✓ Clean |
c1ccc2c(c1)cccc2c3cc4cnc(nc4nc3N5CC[C@H](C5)N)N
|
|
| OA1 RCSB PDB | P24182 | 267.1 Da LogP 2.25 TPSA 69.1 | ✓ Ro5 | ✓ Clean |
c1cc(cc(c1)Br)C(=O)c2cnc(o2)N
|
|
| OA2 RCSB PDB | P24182 | 307.4 Da LogP 3.10 TPSA 72.4 | ✓ Ro5 | ✓ Clean |
c1ccc(cc1)CN(Cc2ccccc2)C(=O)c3cnc(o3)N
|
|
| OA3 RCSB PDB | P24182 | 191.2 Da LogP 1.21 TPSA 68.9 | ✓ Ro5 | ✓ Clean |
CC1(Cc2c(c(ncn2)N)C(=O)C1)C
|
|
| OA4 RCSB PDB | P24182 | 250.3 Da LogP 2.77 TPSA 77.8 | ✓ Ro5 | ✓ Clean |
Cc1c(ccc2c1c(nc(n2)N)N)c3ccccc3
|
|
| OA5 RCSB PDB | P24182 | 247.3 Da LogP 0.49 TPSA 109.2 | ✓ Ro5 | ✓ Clean |
c1ccc(cc1)OCCOc2nc(nc(n2)N)N
|
|
| OXL RCSB PDB | Q2K340 | 88.0 Da LogP -3.51 TPSA 80.3 | ✓ Ro5 | ✓ Clean |
C(=O)(C(=O)[O-])[O-]
|
|
| PAE RCSB PDB | Q2K340 | 140.0 Da LogP -0.75 TPSA 94.8 | ✓ Ro5 | ✓ Clean |
C(C(=O)O)P(=O)(O)O
|
|
| PCT RCSB PDB | P43873 | 139.0 Da LogP -1.35 TPSA 100.6 | ✓ Ro5 | ✓ Clean |
C(C(=O)N)P(=O)(O)O
|
|
| PPF RCSB PDB | P43873 | 126.0 Da LogP -0.16 TPSA 94.8 | ✓ Ro5 | ✓ Clean |
C(=O)(O)P(=O)(O)O
|
|
| PYR RCSB PDB | Q2K340 | 88.1 Da LogP -0.34 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CC(=O)C(=O)O
|
|
| SRT RCSB PDB | Q0P8W7 | 150.1 Da LogP -2.12 TPSA 115.1 | ✓ Ro5 | ✓ Clean |
[C@H]([C@H](C(=O)O)O)(C(=O)O)O
|
|
| TLA RCSB PDB | Q0P8W7 | 150.1 Da LogP -2.12 TPSA 115.1 | ✓ Ro5 | ✓ Clean |
[C@@H]([C@H](C(=O)O)O)(C(=O)O)O
|
|
| Y7Y RCSB PDB | P43873 | 316.4 Da LogP 1.36 TPSA 84.9 | ✓ Ro5 | ✓ Clean |
COC(=O)CCCC[C@H]1[C@@H]2[C@H](CS1)N(C(=O)N2)C(=…
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
| Ligand | UniProt (homolog) | pchembl | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| CHEMBL4466052 ChEMBL | P37798 | 7.50 ~31.6 nM | 378.8 Da LogP 3.58 TPSA 112.8 | ✓ Ro5 | ✓ Clean |
COc1ccc(-c2cccc(Cl)c2-c2cc3cnc(N)nc3nc2N)cn1
|
| CHEMBL4518489 ChEMBL | P37798 | 7.48 ~33.1 nM | 387.3 Da LogP 2.97 TPSA 94.0 | ✓ Ro5 | ✓ Clean |
Nc1ncc2cc(-c3c(Cl)cccc3Cl)c(N3C[C@@H]4[C@@H](N)…
|
| CHEMBL4530311 ChEMBL | P37798 | 7.44 ~36.3 nM | 348.8 Da LogP 3.57 TPSA 103.6 | ✓ Ro5 | ✓ Clean |
Nc1ncc2cc(-c3c(Cl)cccc3-c3cccnc3)c(N)nc2n1
|
| CHEMBL4459017 ChEMBL | P37798 | 7.19 ~64.6 nM | 389.3 Da LogP 3.37 TPSA 94.0 | ✓ Ro5 | ✓ Clean |
NCC1CCN(c2nc3nc(N)ncc3cc2-c2c(Cl)cccc2Cl)C1
|
| CHEMBL4450292 ChEMBL | P37798 | 7.10 ~79.4 nM | 313.4 Da LogP 3.52 TPSA 90.7 | ✓ Ro5 | ✓ Clean |
Nc1ncc2cc(-c3ccccc3-c3ccccc3)c(N)nc2n1
|
| CHEMBL4563086 ChEMBL | P37798 | 7.08 ~83.2 nM | 405.3 Da LogP 2.48 TPSA 114.2 | ✓ Ro5 | ✓ Clean |
NCC1(O)CCN(c2nc3nc(N)ncc3cc2-c2c(Cl)cccc2Cl)C1
|
| CHEMBL4445287 ChEMBL | P37798 | 7.03 ~93.3 nM | 343.8 Da LogP 3.54 TPSA 99.9 | ✓ Ro5 | ✓ Clean |
CC(C)COc1cccc(Cl)c1-c1cc2cnc(N)nc2nc1N
|
| CHEMBL4551132 ChEMBL | P37798 | 6.89 ~128.8 nM | 314.4 Da LogP 2.92 TPSA 103.6 | ✓ Ro5 | ✓ Clean |
Nc1ncc2cc(-c3ccccc3-c3cccnc3)c(N)nc2n1
|
| CHEMBL4564355 ChEMBL | P37798 | 6.85 ~141.3 nM | 390.3 Da LogP 3.40 TPSA 88.2 | ✓ Ro5 | ✓ Clean |
Nc1ncc2cc(-c3c(Cl)cccc3Cl)c(N3CCC(CO)C3)nc2n1
|
| CHEMBL4582507 ChEMBL | P37798 | 6.77 ~169.8 nM | 403.3 Da LogP 2.89 TPSA 111.0 | ✓ Ro5 | ✓ Clean |
NC(=O)C1CCN(c2nc3nc(N)ncc3cc2-c2c(Cl)cccc2Cl)C1
|
| CHEMBL57531 ChEMBL | P37798 | 6.75 ~177.8 nM | 395.1 Da LogP 3.38 TPSA 90.7 | ✓ Ro5 | ✓ Clean |
Nc1ncc2cc(-c3c(Br)cccc3Br)c(N)nc2n1
|
| CHEMBL4440951 ChEMBL | P37798 | 6.72 ~190.5 nM | 405.3 Da LogP 2.48 TPSA 114.2 | ✓ Ro5 | ✓ Clean |
Nc1ncc2cc(-c3c(Cl)cccc3Cl)c(N3CCC(N)(CO)C3)nc2n1
|
| CHEMBL4464608 ChEMBL | P37798 | 6.50 ~316.2 nM | 403.3 Da LogP 3.76 TPSA 94.0 | ✓ Ro5 | ✓ Clean |
NCC1CCN(c2nc3nc(N)ncc3cc2-c2c(Cl)cccc2Cl)CC1
|
| CHEMBL58627 ChEMBL | P37798 | 6.50 ~316.2 nM | 306.2 Da LogP 3.16 TPSA 90.7 | ✓ Ro5 | ✓ Clean |
Nc1ncc2cc(-c3c(Cl)cccc3Cl)c(N)nc2n1
|
| CHEMBL4520904 ChEMBL | P37798 | 6.36 ~436.5 nM | 407.3 Da LogP 3.46 TPSA 94.0 | ✓ Ro5 | ✓ Clean |
NCC1(F)CCN(c2nc3nc(N)ncc3cc2-c2c(Cl)cccc2Cl)C1
|
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC13542455 ZINC | 1.000 | 372.5 Da LogP 0.41 TPSA 133.5 | ✓ Ro5 | ✓ Clean |
N[C@H](CCCCNC(=O)CCCC[C@@H]1SC[C@@H]2NC(=O)N[C@…
|
| ZINC2209 ZINC | 1.000 | 203.2 Da LogP 1.33 TPSA 69.6 | ✓ Ro5 | ✓ Clean |
CC(C)=CCn1cnc(N)c2ncnc1-2
|
| ZINC2557486 ZINC | 1.000 | 334.2 Da LogP 3.59 TPSA 69.6 | ✓ Ro5 | ✓ Clean |
Cc1nc(-c2ccnc(N)n2)cn1Cc1c(Cl)cccc1Cl
|
| ZINC4096827 ZINC | 1.000 | 372.5 Da LogP 0.41 TPSA 133.5 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCCCNC(=O)CCCC[C@@H]1SC[C@@H]2NC(=O)N[C…
|
| ZINC71756253 ZINC | 1.000 | 372.5 Da LogP 0.41 TPSA 133.5 | ✓ Ro5 | ✓ Clean |
N[C@H](CCCCNC(=O)CCCC[C@H]1SC[C@H]2NC(=O)N[C@H]…
|
| ZINC71756255 ZINC | 1.000 | 372.5 Da LogP 0.41 TPSA 133.5 | ✓ Ro5 | ✓ Clean |
N[C@H](CCCCNC(=O)CCCC[C@@H]1SC[C@@H]2NC(=O)N[C@…
|
| ZINC71756256 ZINC | 1.000 | 372.5 Da LogP 0.41 TPSA 133.5 | ✓ Ro5 | ✓ Clean |
N[C@H](CCCCNC(=O)CCCC[C@@H]1SC[C@H]2NC(=O)N[C@H…
|
| ZINC71756257 ZINC | 1.000 | 372.5 Da LogP 0.41 TPSA 133.5 | ✓ Ro5 | ✓ Clean |
N[C@H](CCCCNC(=O)CCCC[C@@H]1SC[C@H]2NC(=O)N[C@@…
|
| ZINC105469665 ZINC | 0.873 | 425.2 Da LogP -1.64 TPSA 223.4 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CO[P@@](=O)(O)CP(=O…
|
| ZINC13527614 ZINC | 0.873 | 425.2 Da LogP -1.64 TPSA 223.4 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CO[P@](=O)(O)CP(=O)…
|
| ZINC219330894 ZINC | 0.873 | 425.2 Da LogP -1.64 TPSA 223.4 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CO[P@](=O)(O)CP(=O)…
|
| ZINC3873852 ZINC | 0.873 | 425.2 Da LogP -1.64 TPSA 223.4 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](CO[P@](=O)(O)CP(=O)…
|
| ZINC3873853 ZINC | 0.873 | 425.2 Da LogP -1.64 TPSA 223.4 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](CO[P@](=O)(O)CP(=O…
|
| ZINC3873854 ZINC | 0.873 | 425.2 Da LogP -1.64 TPSA 223.4 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](CO[P@](=O)(O)CP(=O)…
|
| ZINC3873855 ZINC | 0.873 | 425.2 Da LogP -1.64 TPSA 223.4 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](CO[P@](=O)(O)CP(=O…
|
| ZINC208820459 ZINC | 0.868 | 371.5 Da LogP 0.86 TPSA 140.3 | 1 viol. | ✓ Clean |
N=C(O)[C@H](N)CCCCNC(=O)CCCC[C@@H]1SC[C@H]2NC(=…
|
| ZINC149461335 ZINC | 0.849 | 371.5 Da LogP -0.19 TPSA 139.3 | ✓ Ro5 | ✓ Clean |
NC(=O)[C@H](N)CCCCNC(=O)CCCC[C@@H]1SC[C@@H]2NC(…
|
| ZINC4899883 ZINC | 0.849 | 371.5 Da LogP -0.19 TPSA 139.3 | ✓ Ro5 | ✓ Clean |
NC(=O)[C@@H](N)CCCCNC(=O)CCCC[C@@H]1SC[C@@H]2NC…
|
| ZINC504704915 ZINC | 0.849 | 371.5 Da LogP -0.19 TPSA 139.3 | ✓ Ro5 | ✓ Clean |
NC(=O)[C@H](N)CCCCNC(=O)CCCC[C@@H]1SC[C@H]2NC(=…
|
| ZINC504704916 ZINC | 0.849 | 371.5 Da LogP -0.19 TPSA 139.3 | ✓ Ro5 | ✓ Clean |
NC(=O)[C@H](N)CCCCNC(=O)CCCC[C@@H]1SC[C@@H]2NC(…
|
| ZINC12360002 ZINC | 0.839 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CO[P@@](=O)(O)OP(=O…
|
| ZINC12360703 ZINC | 0.839 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CO[P@@](=O)(O)OP(=O…
|
| ZINC12503599 ZINC | 0.839 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CO[P@@](=O)(O)OP(=O…
|
| ZINC16546165 ZINC | 0.839 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@H](CO[P@](=O)(O)OP(=O)(…
|
| ZINC31977053 ZINC | 0.839 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](CO[P@](=O)(O)OP(=O)…
|
| ZINC4806433 ZINC | 0.839 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CO[P@@](=O)(O)OP(=O…
|
| ZINC53683898 ZINC | 0.839 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](CO[P@@](=O)(O)OP(=…
|
| ZINC8586019 ZINC | 0.839 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](CO[P@](=O)(O)OP(=O)…
|
| ZINC8586020 ZINC | 0.839 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](CO[P@@](=O)(O)OP(=…
|
| ZINC8586021 ZINC | 0.839 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](CO[P@@](=O)(O)OP(=O…
|
| ZINC8586022 ZINC | 0.839 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](CO[P@@](=O)(O)OP(=…
|
| ZINC13518964 ZINC | 0.768 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](COP(=O)(O)O)[C@H](…
|
| ZINC1532515 ZINC | 0.768 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](COP(=O)(O)O)[C@H](O…
|
| ZINC1571045 ZINC | 0.768 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](COP(=O)(O)O)[C@@H]…
|
| ZINC1842158 ZINC | 0.768 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](COP(=O)(O)O)[C@H](O…
|
| ZINC2046931 ZINC | 0.768 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](COP(=O)(O)O)[C@H](…
|
| ZINC2126310 ZINC | 0.768 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](COP(=O)(O)O)[C@@H](…
|
| ZINC3201891 ZINC | 0.768 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](COP(=O)(O)O)[C@@H]…
|
| ZINC3201893 ZINC | 0.768 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](COP(=O)(O)O)[C@@H](…
|
| ZINC3830180 ZINC | 0.768 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](COP(=O)(O)O)[C@@H](…
|
| ZINC3860156 ZINC | 0.768 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](COP(=O)(O)O)[C@@H](…
|
| ZINC3977897 ZINC | 0.768 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@H](COP(=O)(O)O)[C@@H](O…
|
| ZINC4806442 ZINC | 0.768 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](COP(=O)(O)O)[C@H](O…
|
| ZINC8613167 ZINC | 0.768 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](COP(=O)(O)O)[C@H](O…
|
| ZINC4096224 ZINC | 0.754 | 346.2 Da LogP -1.90 TPSA 191.9 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CO[P@](N)(=O)O)[C@@…
|
| ZINC12503850 ZINC | 0.750 | 427.3 Da LogP -2.04 TPSA 229.4 | 1 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CO[P@](=O)(O)OS(=O)…
|
| ZINC141161066 ZINC | 0.750 | 427.3 Da LogP -2.04 TPSA 229.4 | 1 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CO[P@](=O)(O)OS(=O)…
|
| ZINC141163786 ZINC | 0.750 | 427.3 Da LogP -2.04 TPSA 229.4 | 1 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CO[P@](=O)(O)OS(=O)…
|
| ZINC4228246 ZINC | 0.750 | 427.3 Da LogP -2.04 TPSA 229.4 | 1 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CO[P@@](=O)(O)OS(=O…
|
| ZINC27309014 ZINC | 0.744 | 305.2 Da LogP 3.89 TPSA 64.7 | ✓ Ro5 | ✓ Clean |
Cc1ncc2cc(-c3c(Cl)cccc3Cl)c(N)nc2n1
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.