Protein target profile
HT085_RS00305
N-acetylmuramate alpha-1-phosphate uridylyltransferase MurU
Target candidate with partial support; inspect missing evidence before prioritizing.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- Hit
- Gut microbiome off-target
- Hit
Essentiality
- Essential (DEG)
- N
Localization
- Localization
- Cytoplasmic
Sequence
Primary amino-acid sequence viewer.
MKAMILAAGRGERMRPLTDTTPKPLLDVAGKPLIGWHLCRLKQAGFTEIVINHAWLGRQIENALGDGSAYGVNIAYSPEPAGGLETAGGIAQALPLLGGQPFLVANGDVLTDIDFTAAFQTASSLPGHISAHLWLVGNPPHNPDGDFSLLPDGSVRPEVSGGNGLTFSGVGIYRPEMFDGIEAGSVAKLAPVLLNEMRQNRVSGQKHTGLWLDVGTVCRLKEAQALAAAWK
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Gene Ontology (GO)
1- GO:0016779 Catalysis of the transfer of a nucleotidyl group from one compound (donor) to another (acceptor).
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 2 | 223 | CDD | cd06422 | NTP_transferase_like_1 |
| 1 | 226 | SUPERFAMILY | SSF53448 | Nucleotide-diphospho-sugar transferases |
| 1 | 226 | InterPro | IPR029044 | Nucleotide-diphospho-sugar transferases |
| 1 | 229 | Gene3D | G3DSA:3.90.550.10 | Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A |
| 1 | 229 | InterPro | IPR029044 | Nucleotide-diphospho-sugar transferases |
| 1 | 229 | PANTHER | PTHR43584 | NUCLEOTIDYL TRANSFERASE |
| 2 | 130 | Pfam | PF00483 | Nucleotidyl transferase |
| 2 | 130 | InterPro | IPR005835 | Nucleotidyl transferase domain |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
All structural evidence
Structural evidence
0 + 1Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
HT085_RS00305
|
AlphaFold DB | — | — | full sequence | — | Viewing |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural ligand evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| CDC RCSB PDB | Q8DPI6 | 488.3 Da LogP -2.23 TPSA 215.7 | 1 viol. | ✓ Clean |
C[N+](C)(C)CCO[P@@](=O)([O-])O[P@@](=O)(O)OC[C@…
|
|
| DAU RCSB PDB | A0A6L8PCC3 | 564.3 Da LogP -3.46 TPSA 276.8 | 3 viol. | ✓ Clean |
CC1=CN(C(=O)NC1=O)[C@H]2C[C@@H]([C@H](O2)CO[P@]…
|
|
| POP RCSB PDB | A0A6L8PCC3 | 176.0 Da LogP -2.08 TPSA 129.9 | ✓ Ro5 | ✓ Clean |
O[P@@](=O)([O-])O[P@@](=O)(O)[O-]
|
|
| TRH RCSB PDB | A4JC15 | 548.3 Da LogP -2.43 TPSA 256.5 | 3 viol. | ✓ Clean |
C[C@H]1[C@@H]([C@H]([C@H]([C@H](O1)O[P@](=O)(O)…
|
|
| TTP RCSB PDB | P61887 | 482.2 Da LogP -1.16 TPSA 244.1 | 2 viol. | ✓ Clean |
CC1=CN(C(=O)NC1=O)[C@H]2C[C@@H]([C@H](O2)CO[P@]…
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC33979251 ZINC | 1.000 | 482.2 Da LogP -1.16 TPSA 244.1 | 2 viol. | ✓ Clean |
Cc1cn([C@@H]2C[C@H](O)[C@H](CO[P@@](=O)(O)O[P@@…
|
| ZINC12503053 ZINC | 0.959 | 402.2 Da LogP -1.28 TPSA 197.6 | ✓ Ro5 | ✓ Clean |
Cc1cn([C@@H]2C[C@H](O)[C@@H](CO[P@@](=O)(O)OP(=…
|
| ZINC33979243 ZINC | 0.959 | 402.2 Da LogP -1.28 TPSA 197.6 | ✓ Ro5 | ✓ Clean |
Cc1cn([C@@H]2C[C@H](O)[C@H](CO[P@@](=O)(O)OP(=O…
|
| ZINC33979244 ZINC | 0.959 | 402.2 Da LogP -1.28 TPSA 197.6 | ✓ Ro5 | ✓ Clean |
Cc1cn([C@H]2C[C@H](O)[C@H](CO[P@@](=O)(O)OP(=O)…
|
| ZINC33979245 ZINC | 0.959 | 402.2 Da LogP -1.28 TPSA 197.6 | ✓ Ro5 | ✓ Clean |
Cc1cn([C@@H]2C[C@@H](O)[C@H](CO[P@@](=O)(O)OP(=…
|
| ZINC33979246 ZINC | 0.959 | 402.2 Da LogP -1.28 TPSA 197.6 | ✓ Ro5 | ✓ Clean |
Cc1cn([C@H]2C[C@@H](O)[C@H](CO[P@@](=O)(O)OP(=O…
|
| ZINC8215882 ZINC | 0.959 | 402.2 Da LogP -1.28 TPSA 197.6 | ✓ Ro5 | ✓ Clean |
Cc1cn([C@H]2C[C@H](O)[C@@H](CO[P@@](=O)(O)OP(=O…
|
| ZINC111459735 ZINC | 0.836 | 481.2 Da LogP -1.20 TPSA 249.9 | 2 viol. | ✓ Clean |
Cc1cn([C@@H]2C[C@H](N)[C@H](CO[P@@](=O)(O)O[P@@…
|
| ZINC138164075 ZINC | 0.836 | 498.2 Da LogP 0.21 TPSA 227.1 | 2 viol. | ✓ Clean |
Cc1cn([C@@H]2C[C@H](O)[C@H](CO[P@@](=O)(O)O[P@@…
|
| ZINC142512519 ZINC | 0.818 | 498.2 Da LogP 0.21 TPSA 227.1 | 2 viol. | ✓ Clean |
Cc1cn([C@@H]2C[C@H](O)[C@H](CO[P@@](=O)(O)O[P@@…
|
| ZINC13523519 ZINC | 0.804 | 322.2 Da LogP -1.40 TPSA 151.1 | ✓ Ro5 | ✓ Clean |
Cc1cn([C@@H]2C[C@@H](O)[C@@H](COP(=O)(O)O)O2)c(…
|
| ZINC1532628 ZINC | 0.804 | 322.2 Da LogP -1.40 TPSA 151.1 | ✓ Ro5 | ✓ Clean |
Cc1cn([C@@H]2C[C@@H](O)[C@H](COP(=O)(O)O)O2)c(=…
|
| ZINC1678872 ZINC | 0.804 | 322.2 Da LogP -1.40 TPSA 151.1 | ✓ Ro5 | ✓ Clean |
Cc1cn([C@H]2C[C@H](O)[C@@H](COP(=O)(O)O)O2)c(=O…
|
| ZINC2047010 ZINC | 0.804 | 322.2 Da LogP -1.40 TPSA 151.1 | ✓ Ro5 | ✓ Clean |
Cc1cn([C@H]2C[C@@H](O)[C@H](COP(=O)(O)O)O2)c(=O…
|
| ZINC3870253 ZINC | 0.804 | 322.2 Da LogP -1.40 TPSA 151.1 | ✓ Ro5 | ✓ Clean |
Cc1cn([C@@H]2C[C@H](O)[C@H](COP(=O)(O)O)O2)c(=O…
|
| ZINC3870254 ZINC | 0.804 | 322.2 Da LogP -1.40 TPSA 151.1 | ✓ Ro5 | ✓ Clean |
Cc1cn([C@H]2C[C@H](O)[C@H](COP(=O)(O)O)O2)c(=O)…
|
| ZINC6523446 ZINC | 0.804 | 322.2 Da LogP -1.40 TPSA 151.1 | ✓ Ro5 | ✓ Clean |
Cc1cn([C@@H]2C[C@H](O)[C@@H](COP(=O)(O)O)O2)c(=…
|
| ZINC113218151 ZINC | 0.800 | 486.1 Da LogP -1.33 TPSA 244.1 | 2 viol. | ✓ Clean |
O=c1[nH]c(=O)n([C@H]2C[C@H](O)[C@@H](CO[P@](=O)…
|
| ZINC80168152 ZINC | 0.800 | 486.1 Da LogP -1.33 TPSA 244.1 | 2 viol. | ✓ Clean |
O=c1[nH]c(=O)n([C@@H]2C[C@H](O)[C@H](CO[P@@](=O…
|
| ZINC59206718 ZINC | 0.786 | 498.2 Da LogP -1.98 TPSA 264.4 | 2 viol. | ✓ Clean |
O=c1[nH]c(=O)n([C@@H]2C[C@H](O)[C@H](CO[P@@](=O…
|
| ZINC138954515 ZINC | 0.772 | 496.2 Da LogP -1.66 TPSA 261.2 | 2 viol. | ✓ Clean |
O=Cc1cn([C@@H]2C[C@H](O)[C@H](CO[P@@](=O)(O)O[P…
|
| ZINC13519271 ZINC | 0.750 | 466.2 Da LogP -0.13 TPSA 223.9 | ✓ Ro5 | ✓ Clean |
Cc1cn([C@H]2CC[C@@H](CO[P@@](=O)(O)O[P@@](=O)(O…
|
| ZINC13519607 ZINC | 0.750 | 498.2 Da LogP -2.19 TPSA 264.4 | 2 viol. | ✓ Clean |
Cc1cn([C@@H]2O[C@H](CO[P@](=O)(O)O[P@](=O)(O)OP…
|
| ZINC13546289 ZINC | 0.750 | 466.2 Da LogP -0.13 TPSA 223.9 | ✓ Ro5 | ✓ Clean |
Cc1cn([C@@H]2CC[C@H](CO[P@@](=O)(O)O[P@@](=O)(O…
|
| ZINC31298140 ZINC | 0.750 | 498.2 Da LogP -2.19 TPSA 264.4 | 2 viol. | ✓ Clean |
Cc1cn([C@@H]2O[C@H](CO[P@@](=O)(O)O[P@@](=O)(O)…
|
| ZINC81168754 ZINC | 0.750 | 498.2 Da LogP -2.19 TPSA 264.4 | 2 viol. | ✓ Clean |
Cc1cn([C@@H]2O[C@H](CO[P@@](=O)(O)O[P@@](=O)(O)…
|
| ZINC81168756 ZINC | 0.750 | 498.2 Da LogP -2.19 TPSA 264.4 | 2 viol. | ✓ Clean |
Cc1cn([C@@H]2O[C@H](CO[P@@](=O)(O)O[P@@](=O)(O)…
|
| ZINC17107637 ZINC | 0.741 | 320.2 Da LogP -1.46 TPSA 162.7 | ✓ Ro5 | ✓ Clean |
Cc1cn([C@@H]2C[C@@H](O)[C@@H](COP(N)(N)=O)O2)c(…
|
| ZINC17107641 ZINC | 0.741 | 320.2 Da LogP -1.46 TPSA 162.7 | ✓ Ro5 | ✓ Clean |
Cc1cn([C@@H]2C[C@H](O)[C@@H](COP(N)(N)=O)O2)c(=…
|
| ZINC5493427 ZINC | 0.741 | 320.2 Da LogP -1.46 TPSA 162.7 | ✓ Ro5 | ✓ Clean |
Cc1cn([C@@H]2C[C@H](O)[C@H](COP(N)(N)=O)O2)c(=O…
|
| ZINC5493430 ZINC | 0.741 | 320.2 Da LogP -1.46 TPSA 162.7 | ✓ Ro5 | ✓ Clean |
Cc1cn([C@@H]2C[C@@H](O)[C@H](COP(N)(N)=O)O2)c(=…
|
| ZINC136472074 ZINC | 0.737 | 482.2 Da LogP -1.16 TPSA 244.1 | 2 viol. | ✓ Clean |
Cc1cn([C@@H]2O[C@H](CO[P@@](=O)(O)O[P@@](=O)(O)…
|
| ZINC13507072 ZINC | 0.730 | 482.2 Da LogP -1.16 TPSA 244.1 | 2 viol. | ✓ Clean |
Cc1cn([C@@H]2C[C@@H](O)[C@H](CO[P@@](=O)(O)O[P@…
|
| ZINC13518650 ZINC | 0.714 | 418.2 Da LogP -2.31 TPSA 217.8 | 1 viol. | ✓ Clean |
Cc1cn([C@@H]2O[C@H](CO[P@@](=O)(O)OP(=O)(O)O)[C…
|
| ZINC8215959 ZINC | 0.707 | 482.2 Da LogP -0.75 TPSA 244.4 | 2 viol. | ✓ Clean |
Cc1cn([C@H]2C[C@H](O)[C@@H](CO[P@@](=O)(O)O[P@@…
|
| ZINC12501922 ZINC | 0.702 | 468.1 Da LogP -1.47 TPSA 244.1 | 2 viol. | ✓ Clean |
O=c1ccn([C@@H]2C[C@H](O)[C@@H](CO[P@@](=O)(O)O[…
|
| ZINC13436738 ZINC | 0.702 | 468.1 Da LogP -1.47 TPSA 244.1 | 2 viol. | ✓ Clean |
O=c1ccn([C@@H]2C[C@H](O)[C@H](CO[P@@](=O)(O)O[P…
|
| ZINC13436741 ZINC | 0.702 | 468.1 Da LogP -1.47 TPSA 244.1 | 2 viol. | ✓ Clean |
O=c1ccn([C@H]2C[C@H](O)[C@H](CO[P@@](=O)(O)O[P@…
|
| ZINC13436743 ZINC | 0.702 | 468.1 Da LogP -1.47 TPSA 244.1 | 2 viol. | ✓ Clean |
O=c1ccn([C@@H]2C[C@@H](O)[C@H](CO[P@@](=O)(O)O[…
|
| ZINC13436745 ZINC | 0.702 | 468.1 Da LogP -1.47 TPSA 244.1 | 2 viol. | ✓ Clean |
O=c1ccn([C@H]2C[C@@H](O)[C@H](CO[P@@](=O)(O)O[P…
|
| ZINC62612120 ZINC | 0.695 | 481.2 Da LogP -0.87 TPSA 250.2 | 2 viol. | ✓ Clean |
Cc1cn([C@@H]2C[C@H](O)[C@H](CO[P@@](=O)(O)O[P@@…
|
| ZINC6667024 ZINC | 0.679 | 256.3 Da LogP -0.86 TPSA 93.5 | ✓ Ro5 | ✓ Clean |
COC[C@H]1O[C@@H](n2cc(C)c(=O)[nH]c2=O)C[C@@H]1O
|
| ZINC12502783 ZINC | 0.672 | 464.2 Da LogP -0.36 TPSA 223.9 | ✓ Ro5 | ✓ Clean |
Cc1cn([C@H]2C=C[C@@H](CO[P@](=O)(O)O[P@@](=O)(O…
|
| ZINC13520531 ZINC | 0.672 | 443.3 Da LogP 0.60 TPSA 183.2 | ✓ Ro5 | ✓ Clean |
Cc1cn([C@H]2C[C@H](O)[C@@H](CO[P@](=O)(O)Oc3ccc…
|
| ZINC8217150 ZINC | 0.667 | 388.2 Da LogP -1.59 TPSA 197.6 | ✓ Ro5 | ✓ Clean |
O=c1ccn([C@H]2C[C@H](O)[C@@H](CO[P@@](=O)(O)OP(…
|
| ZINC11422512 ZINC | 0.655 | 402.2 Da LogP -1.28 TPSA 197.6 | ✓ Ro5 | ✓ Clean |
Cc1cn([C@H]2C[C@H](OP(=O)(O)O)[C@@H](COP(=O)(O)…
|
| ZINC1592320 ZINC | 0.643 | 285.3 Da LogP -1.41 TPSA 136.6 | ✓ Ro5 | ✓ Clean |
Cc1cn([C@@H]2C[C@@H](O)[C@H](COC(N)=O)O2)c(=O)[…
|
| ZINC4918678 ZINC | 0.643 | 285.3 Da LogP -1.41 TPSA 136.6 | ✓ Ro5 | ✓ Clean |
Cc1cn([C@@H]2C[C@H](O)[C@H](COC(N)=O)O2)c(=O)[n…
|
| ZINC4918681 ZINC | 0.643 | 285.3 Da LogP -1.41 TPSA 136.6 | ✓ Ro5 | ✓ Clean |
Cc1cn([C@H]2C[C@H](O)[C@H](COC(N)=O)O2)c(=O)[nH…
|
| ZINC4918686 ZINC | 0.643 | 285.3 Da LogP -1.41 TPSA 136.6 | ✓ Ro5 | ✓ Clean |
Cc1cn([C@H]2C[C@@H](O)[C@H](COC(N)=O)O2)c(=O)[n…
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.