Protein target profile

HT085_RS00330

acyltransferase family protein

Genome: NZ_AP023069.1 Gene: NGO_0065 oatA_1 WHOF_01980 oatA_2 TUM19854C_00550 N776_08995 WHOF_00066 ESCNG_350011 3D evidence: AlphaFold DB model UniProt A0AA44ZGS2 UniProt Q5FAF8 UniProt A0AB74EFC0
Export view
Length 624
Functional annotation 0 EC 4 GO
Target summary

Target candidate with partial support; inspect missing evidence before prioritizing.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Main supporting evidence

No similar human protein detected The current BLAST sequence screen did not find a significant human match, lowering apparent off-target risk. Structure available AlphaFold DB model

Risks to review

No major risk signal surfaced in the loaded evidence.

Evidence gaps

No metabolic context No SBML/network-derived reaction evidence is loaded for this protein. No FPocket pocket score No selected computational pocket-druggability value is available. No ligand evidence No experimental PDB ligands, measured ChEMBL bioactivity, or proposed ZINC compound records are available.
Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome off-target
Hit

Essentiality

Essential (DEG)
N

Localization

Localization
CytoplasmicMembrane

Binding-site evidence

The selected pocket score is the FPocket value used for ranking after applying the curated structure priority. It estimates small-molecule pocket quality; it is not experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

FPocket High
Structure –
Pocket –

Sequence

Primary amino-acid sequence viewer.

MSQALPYRPDIDTLRAAAVLSVIVFHIEKDWLPGGFLGVDIFFVISGFLMTAILLREMSGGRFFLKTFYIRRIKRILPAFFAVLAATLAGGFFLFTKDDFFLLWKSALTALGFASNLYFARGKDYFDPAQEEKPLLHIWSLSVEEQFYFVFPILLLLVARKSLRVQFGFLAALCALSLAASFMPSALDKYYLPHLRACEMLVGSLTAVRMRYRQQRNPAVGKRYAAVGALFSACILSACLFAYSEQTAYFPGPAALIPCLAVAALIYFNHYEHPLKKFFQWKITVAAGLISYSLYLWHWPILAFMRYIGPDNLPPYSPAAAIVLTLAFSLISYHCIEKPFKKWKGSFAQSVLWIYALPMLVLGAGSFFAMRLPFMAQYDRLGLTRSNTSCHNNTGKQCLWGDTEKQPELLVLGDSHADHYKTFFDAVGKKEKWSATMVSADACAYVEGYASRVFQNWAACRAVYRYAEEHLPRYPKVVLAMRWGSQMPENSRSLAYDAGFFQKFDRMLHKLSSEKQAVYLMADNLASSYNVQRAYILSSRIPGCRQTLRPDDESTLKANARIRELAAKYPNVYIIDAAAYIPADFQIGGLPVYSDKDHINPYGGTELAKRFSEKQRFLDTRHNH

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

4 GO

Gene Ontology (GO)

4
  • GO:0016747 Catalysis of the transfer of an acyl group, other than amino-acyl, from one compound (donor) to another (acceptor).
  • GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
  • GO:0016788 Catalysis of the hydrolysis of any ester bond.
  • GO:0009103 The chemical reactions and pathways resulting in the formation of lipopolysaccharides, any of a group of related, structurally complex components of the outer membrane of Gram-negative bacteria.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

38 records
Show feature table
Start End DB Term Name
213 223 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
96 100 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
193 212 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
56 75 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
225 244 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
1 34 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
35 55 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
371 624 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
135 157 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
76 95 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
9 331 Pfam PF01757 Acyltransferase family
9 331 InterPro IPR002656 Acyltransferase 3 domain
249 269 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
100 122 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
390 612 Pfam PF19040 SGNH domain (fused to AT3 domains)
390 612 InterPro IPR043968 SGNH domain
224 243 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
315 337 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
270 280 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
300 318 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
188 192 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
33 55 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
391 615 Gene3D G3DSA:3.40.50.1110 SGNH hydrolase
391 615 InterPro IPR036514 SGNH hydrolase superfamily
278 300 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
121 166 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
244 248 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
249 271 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
281 299 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
167 187 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
101 120 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
319 336 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
76 95 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
337 347 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
350 372 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
348 370 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
167 186 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
8 447 PANTHER PTHR23028 ACETYLTRANSFERASE

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · FPocket

Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Site 1 FPocket #4
0.903
Likely same site as P2Rank 5 1.9 Å 11 shared residues 100% of smaller site
Show in viewer
Surrounding area
Site 2 FPocket #9
0.625
Show in viewer
Surrounding area
Site 3 FPocket #13
0.458
Show in viewer
Surrounding area
Site 4 FPocket #6
0.358
Show in viewer
Surrounding area

Binding pockets · P2Rank

Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Site 1 P2Rank #1
0.901
Show in viewer
Surrounding area
Site 2 P2Rank #2
0.842
Show in viewer
Surrounding area
Site 3 P2Rank #3
0.622
Show in viewer
Surrounding area
Site 4 P2Rank #4
0.449
Show in viewer
Surrounding area
Site 5 P2Rank #5
0.439
Likely same site as FPocket 4 1.9 Å 11 shared residues 100% of smaller site
Show in viewer
Surrounding area
All structural evidence 0 experimental · 1 predicted

Structural evidence

0 + 1

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB HT085_RS00330
AlphaFold DB — — full sequence — Viewing