Protein profile

PA0059

osmotically inducible protein OsmC

Genome: NC_002516.2

Gene: osmC PA0059 Structure source: AlphaFold UniProt Q9I773
Export view
Amino acids 151
Annotations 4
Features 9
PDB binders 0
Druggability 0.67

Overview

Basic information about this protein and its source genome.

Accession
PA0059
Assembly
Pseudomonas aeruginosa PAO1, complete genome
Gene
osmC PA0059
Status
annotated
Amino acids
151
Structure source
AlphaFold
GO
GO:0005829 The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes. GO:0051920 Catalysis of the reaction: [protein]-dithol + ROOH = [protein]-disulfide + H2O + ROH. GO:0006979 Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of oxidative stress, a state often resulting from exposure to high levels of reactive oxygen species, e.g. superoxide anions, hydrogen peroxide (H2O2), and hydroxyl radicals. GO:0004601 Catalysis of the reaction: a reduced substrate + ROOH = an oxidized substrate + ROH + H2O.

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.67
Structure –
Pocket –

Sequence

Primary amino-acid sequence viewer.

MSIHSSGGVDMKKTASAVWQGGLKDGKGTLSTESGALKDNPYGFNTRFEGAPGTNPEELIGAAHAGCFSMALSMMLGEAGLTAERIETRAEVTLDKQSDGFAITAVHLVLRARVPGADAQTFEQIANKAKAGCPVSKVLNAKISLDASLDG

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

4 GO

Gene Ontology (GO)

4
  • GO:0005829 The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
  • GO:0051920 Catalysis of the reaction: [protein]-dithol + ROOH = [protein]-disulfide + H2O + ROH.
  • GO:0006979 Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of oxidative stress, a state often resulting from exposure to high levels of reactive oxygen species, e.g. superoxide anions, hydrogen peroxide (H2O2), and hydroxyl radicals.
  • GO:0004601 Catalysis of the reaction: a reduced substrate + ROOH = an oxidized substrate + ROH + H2O.

Sequence Features

Domain/signature hits from InterPro and related databases.

9 records
Show feature table
Start End DB Term Name
53 145 Pfam PF02566 OsmC-like protein
53 145 InterPro IPR003718 OsmC/Ohr family
10 150 PANTHER PTHR42830 OSMOTICALLY INDUCIBLE FAMILY PROTEIN
12 147 NCBIfam TIGR03562 OsmC family peroxiredoxin
12 147 InterPro IPR019904 Peroxiredoxin OsmC
9 150 Gene3D G3DSA:3.30.300.20 -
9 150 InterPro IPR015946 K homology domain-like, alpha/beta
10 149 SUPERFAMILY SSF82784 OsmC-like
10 149 InterPro IPR036102 OsmC/Ohr superfamily

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA0059
AlphaFold — — full sequence — Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.67