Protein profile

PA0080

hypothetical protein

Genome: NC_002516.2

Gene: PA0080 Structure source: Experimental + AlphaFold UniProt Q9I752

Export view

Amino acids 154

Annotations 0

Features 17

PDB binders 0

Druggability 0.689

Overview

Basic information about this protein and its source genome.

Accession: PA0080
Assembly: Pseudomonas aeruginosa PAO1, complete genome
Gene: PA0080
Status: annotated
Amino acids: 154
Structure source: Experimental + AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target: No hit
Gut microbiome off-target: hit
Essential (DEG): N
Localization: CytoplasmicMembrane

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.689

Structure –

Pocket –

Sequence

Primary amino-acid sequence viewer.

MQKLIVALFGLLLAACSSSPPETPPTRVVIWLHAAPNLNPSAAGQAAPLRLRLYELKKDTAFGRADYFALTDNAQSTLGGDLVEQDEFLLRPGEERRIERTLDEQTRQLGFVAAYRDLDRATWRQVLDVPGQRTSHLDITLGAQAIGIVARPAP

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

No GO or EC annotations are currently loaded for this protein.

Sequence Features

Domain/signature hits from InterPro and related databases.

17 records

Show feature table

Start	End	DB	Term	Name
4	14	Phobius	SIGNAL_PEPTIDE_H_REGION	Hydrophobic region of a signal peptide.
24	154	Gene3D	G3DSA:2.60.40.4150	Type VI secretion system, lipoprotein SciN
24	154	InterPro	IPR038706	Type VI secretion protein SciN-like superfamily
2	148	PANTHER	PTHR37625	OUTER MEMBRANE LIPOPROTEIN-RELATED
2	148	InterPro	IPR017734	Type VI secretion system, lipoprotein SciN
1	3	Phobius	SIGNAL_PEPTIDE_N_REGION	N-terminal region of a signal peptide.
15	18	Phobius	SIGNAL_PEPTIDE_C_REGION	C-terminal region of a signal peptide.
27	143	Pfam	PF12790	Type VI secretion lipoprotein, VasD, EvfM, TssJ, VC_A0113
27	143	InterPro	IPR017734	Type VI secretion system, lipoprotein SciN
1	18	Phobius	SIGNAL_PEPTIDE	Signal peptide region
1	17	SignalP_GRAM_POSITIVE	SignalP-TM	SignalP-TM
19	154	Phobius	NON_CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
3	146	NCBIfam	TIGR03352	type VI secretion system lipoprotein TssJ
3	146	InterPro	IPR017734	Type VI secretion system, lipoprotein SciN
1	19	SignalP_GRAM_NEGATIVE	SignalP-noTM	SignalP-noTM
1	18	SignalP_EUK	SignalP-noTM	SignalP-noTM
1	16	ProSiteProfiles	PS51257	Prokaryotic membrane lipoprotein lipid attachment site profile.

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

Loading 3D structure...

Legend High Medium Low

Structural evidence

1 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry	Method	Resolution	Chain	Coverage	Links	Status
PDB 3ZHN	X-ray	1.40 Å	A	89.6% 17-154	PDBe RCSB PDBj File	Viewing
AlphaFold PA0080	AlphaFold	—	—	full sequence	—	Loaded

Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET	Sticks	Spheres	Surfaces	Druggability	Labels	Zoom	Positions
1				0.689

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET	Sticks	Spheres	Surfaces	Druggability	Labels	Zoom	Positions
2				0.728