Protein profile

PA0102

carbonic anhydrase

Genome: NC_002516.2

Gene: PA0102 Structure source: AlphaFold UniProt Q9I730
Amino acids 242
Annotations 5
Features 18
PDB binders 1
Druggability 0.766

Overview

Basic information about this protein and its source genome.

Accession
PA0102
Gene
PA0102
Status
annotated
Amino acids
242
Structure source
AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
Y
Localization
Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.766
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MPDRMRGVKSDSPEQESADDALKRIVDGFQHFRREVFPEQQALFKKLANSQRPRAMFITCADSRIVPELITQSSPGDLFVTRNVGNVVPPYGQMNGGVSTAIEYAVLALGVHHIIVCGHSDCGAMRAVLDPQTLERMPTVKAWLRHAEVARTVVADNCDCGASHDTLGVLTEENVVAQLDHLRTHPSVASRLASGQLFIHGWVYDIESAQIRAYDAKQGRFLPLDGEHPVPMATPAPRYLSS

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 4 GO

Enzyme Commission (EC)

1

Gene Ontology (GO)

4
  • GO:0004089 Catalysis of the reaction: hydrogencarbonate + H+ = CO2 + H2O.
  • GO:0008270 Binding to a zinc ion (Zn).
  • GO:0015976 A series of processes that forms an integrated mechanism by which a cell or an organism detects the depletion of primary carbon sources and then activates genes to scavenge the last traces of the primary carbon source and to transport and metabolize alternative carbon sources such as carbon dioxide or carbonic acid. The utilization process begins when the cell or organism detects carbon levels, includes the activation of genes whose products detect, transport or metabolize carbon-containing substances, and ends when carbon is incorporated into the cell or organism's metabolism.
  • GO:0009440 The chemical reactions and pathways resulting in the breakdown of cyanate, NCO-, the anion of cyanic acid.

Sequence Features

Domain/signature hits from InterPro and related databases.

18 records
Show feature table
Start End DB Term Name
55 210 Pfam PF00484 Carbonic anhydrase
55 210 InterPro IPR001765 Carbonic anhydrase
28 214 CDD cd00884 beta_CA_cladeB
28 214 InterPro IPR045066 Beta carbonic anhydrases, cladeB
103 123 ProSitePatterns PS00705 Prokaryotic-type carbonic anhydrases signature 2.
103 123 InterPro IPR015892 Carbonic anhydrase, prokaryotic-like, conserved site
13 218 PANTHER PTHR11002 CARBONIC ANHYDRASE
13 218 InterPro IPR001765 Carbonic anhydrase
1 20 MobiDBLite mobidb-lite consensus disorder prediction
6 223 Gene3D G3DSA:3.40.1050.10 Carbonic anhydrase
6 223 InterPro IPR036874 Carbonic anhydrase superfamily
48 215 SMART SM00947 Pro_CA_2
48 215 InterPro IPR001765 Carbonic anhydrase
11 227 SUPERFAMILY SSF53056 beta-carbonic anhydrase, cab
11 227 InterPro IPR036874 Carbonic anhydrase superfamily
60 67 ProSitePatterns PS00704 Prokaryotic-type carbonic anhydrases signature 1.
60 67 InterPro IPR015892 Carbonic anhydrase, prokaryotic-like, conserved site
17 222 FunFam G3DSA:3.40.1050.10:FF:000003 Carbonic anhydrase

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA0102
AlphaFold full sequence Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
2 0.766

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

106 records

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
AZI P17067 42.0 Da LogP 0.87 TPSA 58.7 ✓ Ro5 Alert [N-]=[N+]=[N-]

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.